KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101152060
Entry
101152060         CDS       T02442                                 

Gene name
ZBED1
Definition
(RefSeq) zinc finger BED domain-containing protein 1
  KO
K24637  zinc finger BED domain-containing protein 1 (E3 SUMO-protein ligase ZBED1) [EC:2.3.2.-]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101152060 (ZBED1)
   04121 Ubiquitin system [BR:ggo04121]
    101152060 (ZBED1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     101152060 (ZBED1)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BED
    101152060 (ZBED1)
Ubiquitin system [BR:ggo04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101152060 (ZBED1)
SSDB
Motif
Pfam: zf-BED Dimer_Tnp_hAT DUF4413
Other DBs
NCBI-GeneID: 101152060
NCBI-ProteinID: XP_018875032
Ensembl: ENSGGOG00000011706
UniProt: G3R7R6
Position
X
AA seq 694 aa
MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNT
SNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDS
KKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAV
REVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSMGSRCLKTFEVPE
ENTAETITRVLYEVFIEWGISAKVFGATTNYGKDIVKACSLLDVAVHMPCLGHTFNAGIQ
QAFQLPKLGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAM
LQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTIS
MVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYK
RLPFLSAFERQQVENRVVEEAKGLLDKVKEGGYRPAEDKIFPVPEEPPVKKLMRTSTPPP
ASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPL
LPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRLAPAHVDEQVFLYENARSGAEAEPE
DQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggagaataaaagcctggagagctcccagacagacctgaagctggtggcccacccccgc
gccaagagcaaggtgtggaagtattttggcttcgacaccaacgccgagggatgcatcctg
cagtggaagaaaatctactgccgcatctgcatggcccagatcgcctactccggaaacacc
tccaacctgtcctaccacctggagaagaaccaccccgaggaattctgcgaattcgtcaag
agcaacacggagcagatgcgtgaagccttcgccaccgccttctccaagctgaagcccgag
tcgtcccagcagcccgggcaggacgcgctggccgtcaaggccggccacggctacgacagc
aagaagcagcaggagctgacggccgccgtgctgggcctcatctgcgaggggctgtacccg
gcctccatcgtggatgagcccaccttcaaggtgctgctgaagacggccgacccccggtat
gagctgcccagccggaagtacatctctaccaaggccatccctgagaagtacggggccgtc
cgggaggtgatcctgaaggagctggccgaggccacctggtgtggcatctccaccgacatg
tggaggagtgagaatcagaaccgcgcctacgtcacgctggccgcccacttcctgggcctg
ggcgcccccaactgcctgtccatgggctcccgctgcctgaagaccttcgaggtgcctgaa
gagaacacggcggagaccatcacgcgggtgctctatgaggtcttcatcgagtggggcatc
agtgcgaaggtcttcggggccaccaccaactatggcaaggacatcgtgaaggcgtgctcc
ctgctggacgtcgcagtgcacatgccctgcctgggccacaccttcaatgctggcatccag
caggccttccagctcccgaagctgggggcgctgctgtcgcgctgccgcaaactggtggag
tacttccagcagtctgccgtggccatgtacatgctctatgagaagcagaagcagcagaac
gtggcccactgcatgctggtgagcaaccgcgtctcctggtgggggagcacgctggccatg
ctgcagcgcctcaaggagcagcagttcgtcatcgccggggtcttggtggaggacagcaac
aaccaccacctcatgctggaggccagcgagtgggccaccatcgaggggctggtggagctc
ctgcagcccttcaagcaggtggccgagatgctgtcggcctccaggtaccccaccatcagc
atggtgaagccgctgctgcacatgctcctgaacaccacgctcaacatcaaggagaccgac
tccaaggagctcagcatggccaaggaggtcatcgccaaggagctttccaagacctaccag
gagacgcccgagatcgacatgtttctcaacgtggccaccttcctggacccccgctacaag
aggctgcccttcctctccgccttcgagcggcagcaggtggagaaccgcgtggtggaagag
gccaagggcctgctggacaaggtcaaagagggcggctaccggccagccgaggacaagatc
ttcccggtgcccgaggagcctcccgtcaagaagctcatgcggacgtccacaccgccgccc
gccagcgtcatcaacaacatgctggccgagatcttctgccagacaggcggcgtggaggac
caggaagagtggcatgcccaggtggtggaggagctgagcaacttcaagtcccagaaggtg
cttggcctcaacgaagaccccctcaagtggtggtcagaccgcctggccctcttccccctg
ctgcccaaggtgctgcagaagtactggtgcgtgacggccacgcgcgtcgcccccgagcgt
ctcttcggttccgccgccaacgtggtcagcgccaagaggaaccggctggctcccgcgcac
gtggacgagcaggtgtttctgtatgagaacgcccggagtggggcggaggcggaacccgag
gaccaggacgagggggagtggggcctggaccaggagcaggtgttctccttgggggatggc
gtcagcggcggtttctttggcatcagggacagcagcttcctgtag

DBGET integrated database retrieval system