KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153049Help
Entry
101153049         CDS       T02442                                 

Gene name
ACKR1, DARC
Definition
(RefSeq) atypical chemokine receptor 1 (Duffy blood group)
  KO
K06574  atypical chemokine receptor 1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo05144  Malaria
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05144 Malaria
    101153049 (ACKR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ggo04030]
    101153049 (ACKR1)
   04050 Cytokine receptors [BR:ggo04050]
    101153049 (ACKR1)
   04090 CD molecules [BR:ggo04090]
    101153049 (ACKR1)
G protein-coupled receptors [BR:ggo04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101153049 (ACKR1)
Cytokine receptors [BR:ggo04050]
 Chemokine receptors
  CC Chemokine
   101153049 (ACKR1)
CD molecules [BR:ggo04090]
 Proteins
  101153049 (ACKR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 101153049
NCBI-ProteinID: XP_004027105
Ensembl: ENSGGOG00000005139
UniProt: Q95LF9
Position
1
AA seq 336 aa AA seqDB search
MGNCLHTAELSPSTENSSQLDFEDAWNSSYDVNYSFPDVDYDANLEAAAPCHSCNLLDDS
ALPFFILTSVLGILASSTVLFILFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPILAPGL
GSTHSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALL
TLPVTLASGASGGLCTPIHSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG
PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT
PLILALFYHQATRTLLPSLPLPEGWSSHLDTLGSKS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgtctgcacacggcggagctctccccctcaactgagaactcaagtcagctg
gacttcgaagatgcatggaattcttcctatgatgtgaattattccttcccagatgtagac
tacgatgccaacctggaagcagctgccccctgccactcctgtaacctgctggatgactct
gcactgcccttcttcatcctcaccagtgtcctgggcatcctagctagcagcactgtcctc
ttcatccttttcagacctctcttccgctggcagctctgccctggctggcctgtcctggca
cagctggctgtgggcagtgccctcttcagcattgtggtgcccattttggccccagggcta
ggtagcactcacagctctgccctgtgtagcctgggctactgtgtctggtatggctcagcc
tttgcccaggctttgctgctagggtgccatgcctccctgggccacagactgggtgcaggc
caggtcccaggcctcaccctggggctcactgtgggaatttggggagtggctgccctactg
acactgcctgtcaccctggccagtggtgcttctggtggactctgcaccccgatacacagc
acggagctgaaggctttgcaggccacacacactgtagcctgtcttgccatctttgtcttg
ttgccattgggtttgtttggagccaaggggctgaagaaggcactgggtatggggccaggc
ccctggatgaatatcctgtgggcctggtttattttctggtggcctcatggggtggttcta
ggactggatttcctggtgaggtccaagctgttgctgttgtcaacatgtctggcccagcag
gctctggacctgctgctgaacctggcagaagccctggcaattttgcactgtgtggctaca
cccctgatcctcgccctattctaccaccaggccacccgcaccctcttgccttctctgccc
ctccctgaaggatggtcttctcatctggacacccttggaagcaaatcctag

DBGET integrated database retrieval system