KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153186
Entry
101153186         CDS       T02442                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ggo03021]
    101153186 (AFF3)
Transcription machinery [BR:ggo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101153186 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 101153186
NCBI-ProteinID: XP_018876766
UniProt: G3SKU4
Position
2A
AA seq 1251 aa
MDSFDLALLQEWDLESLWGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNALRRKERERR
NQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIDEHFVADSRAQTQPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPP
SDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPA
RAKAKLSKFSIPKQGEESRSGETNSCVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKD
SQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDS
AVVQQPNCRTSVPSSKGSSSSSSSGSSSSSSDSESSSGSDSETESSSSESEGSKPPHFSS
PEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYYNPVKEDVQDCGKVPDVCQ
PSLREKEIKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVSAAAPPPTVPCAPAENA
PAPARRSAGKKPTRRTERTSAGDGANCHRPEEPAAADALGTSVVVPPEPTKTRPCGNNRA
SHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQT
VAASASSGNDQRLKEAAANGGNGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLS
PLKDSDEIRSLWVKIDLTLLSRIPEHLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALP
KSKRKRKCDNEDDYREIKKSQGEKDSSSRLATSTSNTLSANHCNMNINSVAIPVNKNEKM
LRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAH
NNSENIPLHKSRPQTEPWSPGSNGHRDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMV
EKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATP
EDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTG
TPSPMSPNPSPASSVGSQGSLSNASALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYW
EMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcactgtggggtgaa
gacatcttaaaccagaggaatgactctctagttgtggaatttcagtcatcagccagcaga
tgcaggagtgtctatgaaccagatagaaatgcattacggaggaaagaacgagaaagaaga
aatcaagaaactcaacaggatgacggcacgtttaattctagttactctctcttcagtgag
ccctacaagactaacaagggggatgaactctccaaccggatccagaacactttaggcaat
tatgatgaaatgaaagactttttaactgatagatccaatcagagtcatctcgttggagtt
cccaaacctggggttcctcagactcctgtgaacaagatcgatgaacattttgttgcagat
tcaagagcccagacccagccctcgtctatctgtagcactacaacttccacaccagcagct
gtccccgtgcagcagagtaagagaggcactatgggctggcagaaggctgggcacccaccc
tccgacggccaacagagagcaacacaacagggctctctcaggaccttgcttggagatggt
gttggcagacagcagccgcgggccaaacaagtgtgcaatgtggaggtgggccttcagacc
caggagaggccacctgccatggcggccaagcacagcagcagcggacactgtgttcagaac
tttcctccatccctagcttcaaaacccagcctggtccagcagaaaccgactgcgtatgtg
cggccaatggacggccaagatcaggcccctgatgagtctcctaagctgaagtcgtcttcg
gaaaccagcgtgcactgcacatcatacaggggagtccctgccagcaagccggagcctgcc
agagccaaggccaagctctccaagttcagcatccccaagcagggggaggagagtagatct
ggagaaaccaacagctgtgttgaagaaataatccgggagatgacctggcttccaccactt
tctgccattcaagcacctggcaaagtggaaccaaccaaatttccatttccaaataaggac
tctcagcttgtatcctctggacacaataatccaaagaaaggtgatgcagagccagagagt
ccagacaatggcacatcgaatacatcaatgctggaagatgaccttaagctaagcagtgat
gaagaggagaatgaacagcaggcagctcagagaacggctctccgcgctctgtctgacagc
gccgtggtccagcagcccaactgcagaacctcggtgccttccagcaagggtagcagcagc
agcagcagcagcggcagcagcagctcctccagcgactcagagagcagctccggatctgac
tcggagaccgagagcagctccagcgagagtgagggcagcaagcccccccacttctccagc
cccgaggctgaaccagcatcctctaacaagtggcagctggataaatggctaaacaaagtt
aatccccacaagcctcctattctgatccaaaatgaaagccacgggccagagagcaatcag
tactacaacccggtgaaagaggacgtccaggactgtgggaaagtccccgacgtttgccag
cccagcctgagagagaaggagatcaagagcacttgcaaggaggagcagaggccaaggaca
gcgaacaaagcccctgggagtaaaggcgtgaagcagaagtccccgcccgcggccgtggcc
gtggcggtgagcgcagccgccccgccacccacagtgccttgtgcgcccgcggagaacgcg
cccgcgcctgcccggaggtccgcgggcaagaagcccaccaggcgcaccgagaggacctca
gccggggacggcgccaactgccaccggcccgaggagcccgcggccgcagacgcgctgggg
acgagcgtggtggtccccccggagcccaccaaaaccaggccctgtggcaacaacagagcg
agccaccgcaaggagctgcgctcctccgtgacctgcgagaagcgccgcacgcgggggctg
agcaggatcgtccccaaatccaaggagttcattgagacagagtcgtcatcttcgtcctcc
tcctcggactccgacctggagtccgagcaggaggagtaccctctgtccaaagcacagacc
gtggctgcctctgcctcctccgggaatgatcagaggctgaaggaggccgctgccaacggg
ggcaatggtcctagggcccctgtaggctccatcaacgccaggaccaccagtgacatcgcg
aaggagctggaggagcagttctacacactggtcccctttggccggaacgaacttctctcc
cctctaaaggacagtgatgagatcaggtctctctgggtcaaaatcgacctgaccctcctg
tccaggatcccagaacacctgccccaggagccaggggtattgagcgcccctgccactaag
gactctgagagcgcaccgcccagccacacctcggacacacctgcagaaaaggctttgcca
aaatccaagaggaaacgcaagtgtgacaacgaagacgactacagggagatcaagaagtcc
cagggagagaaagacagctcttcaagactggccacctccaccagtaatactttgtctgca
aaccactgcaacatgaacatcaacagtgtggcaataccagtaaataaaaatgaaaaaatg
cttcggtcacccatctcacccctctctgatgcatctaaacacaaatacaccagcgaggac
ttaacttcttccagccgacctaatggcaacagtttgtttacttcagcctcttccagcaaa
aagcctaaggccgacagccagctgcagcctcacggcggagacctcacgaaagcagctcac
aacaattccgaaaacattcccctccacaagtcacggccgcagacggagccgtggtctcca
ggctccaacggccacagggactgcaagaggcagaaacttgtcttcgatgacatgcctcgc
agtgccgattattttatgcaagaagctaaacgaatgaagcataaagcagatgcaatggtg
gaaaagtttggaaaggctttgaactatgctgaagcagcattgtcgtttatcgagtgtgga
aatgcaatggaacaaggccccatggaatccaaatctccttatacgatgtattcagaaaca
gtagagctcatcaggtatgctatgagactaaaaacccactcaggccccaatgccacacca
gaagacaaacaactggctgcattatgttaccgatgcctggccctcctatactggcggatg
tttcgactcaaaagggaccacgcagtaaagtattcaaaagcactcatcgactatttcaag
aactcatctaaagctgcccaagccccatctccgtggggggccagtggaaagagcactgga
accccatcccccatgtctcccaacccctctcccgccagctccgtggggtctcagggcagc
ctctccaacgccagcgccctgtccccgtcgaccatcgtcagcatcccacagcgcatccac
cagatggcggccaaccacgtcagcatcaccaacagcatcctgcacagctatgactactgg
gagatggccgacaacctggccaaggaaaaccgagaattcttcaacgacctggatctgctc
atggggccggtcaccctgcacagcagcatggagcacctggtccagtactcccaacagggc
ctgcactggctgcggaacagcgcccacctgtcatag

DBGET integrated database retrieval system