KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153676Help
Entry
101153676         CDS       T02442                                 

Gene name
PIK3C2G
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101153676 (PIK3C2G)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101153676 (PIK3C2G)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     101153676 (PIK3C2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PX PI3K_C2 PI3K_rbd C2 DUF4135 Serum_albumin
Motif
Other DBs
NCBI-GeneID: 101153676
NCBI-ProteinID: XP_018894993
Ensembl: ENSGGOG00000017159
UniProt: A0A2I2Z7Z4
Position
12
AA seq 1486 aa AA seqDB search
MAYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHCESEIDE
NTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSHELSWHQVRKAPAIGFSPSMLPKPQNM
NKECSWGSPIGKHHGADDSRFSILAPSFTSLDKINLEKELENENHNYHIGFESSIPPTNS
SFSSDFMPKEENKRSGHVNIVEPSLILLQGSLQPGMWESTWRKNIESIGCSIQLVEVPQS
SNTSLASFCNKVKKIREGYHAADVSFNSGKIWSTTTAFPYQLFSKTKFNIHIFIDNSTQP
LHFMPCANYLVKDLIAEILHFCTNDHLLPKDHILSVCGSEEFLQNDHCLGSHKMFQKDKS
VIQLHLQKSREAPGKLSRKHEEDHSQFYLNQLLEFMHIWKVSRQCLLTLIRKYDFHLKYL
LKTQENVDNIIEEVKKICSVLGCVETKQITDAVNELSLILQRKAENFYQSSETSAKGLIE
KVTTELSTSVYQLINVYCNSFYADFQPVNVPRCISYLNPGLPSHLSFTVYAAHNIPETWV
HSYKAFSFTCWLTYAGKKLCQVRNYRNIPVKKFFFFLVNWNETINFPLEIKSLPRESMLT
VKLFGIACATNNANLLAWTCLPLFPKEKSILGSMLFSMTLQSEPPVEMIAPGVWDVSQPS
PVTLQIDFPATGWEYMKPDSEENRSNLEEPLKECIKHIARLSQKQTPLLLSEEKKRYLWF
YRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWTFSQPLEALGLLTFSFPDQEIRK
VAVQQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQLLLHRSLQSIQVAHRLYWLLKNA
ENEAYFKSWYQKLLAALQFCAGKALNDEFSKEQKLIKILGDIGEKVKSASDHQRQEVLKK
ETGRLEEFFQDVNTCHLPLNPALCIKGIDHDACSYFTSNALPLKITFINANPMGKNISII
FKAGDDLRQDMLVLQIIQVMDNIWLQEGLDMQMIIYRCLSTGKDQGLVQMVPDAVTLAKI
HRHSGLIGPLKENTIKKWFSQHNHLKADYEKALRNFFYSCAGWCVVTFILGVCDRHNDNI
MLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMEYFITEGGKNPQHFQDFVELC
CHAYNIIRKHSQLLLNLLEMMLYAGLPELSGIQDLKYVYNNLRPQDTDLEATSHFTKKIK
ESLECFPVKLNNLIHTLAQMSAISPAKSTSQTFPQESCLLSTTRSIERATILGFSKKSSN
LYLIQVTHSNNKTSLIEKSFEQFSKLHSQLQKQFASLTLPEFPHWWHLPFTNSDHRRFRD
LNHYMEQILNGSHEVTNSDCVLSFFLSEAVQQTVEESSLVYLGEKFPDKKPKVQLVISYE
DVKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYPSEVRRRKTKSVPKCTDPTYNEIVVYD
EVTELQGHVLMLIVKSKTVFVGAINIRLCSVPLNEEKWYPLGNSII
NT seq 4461 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcttggcaaacggatccaaatcctaatgaatcacatgaaaagcagtatgaa
caccaagaatttctctttgtaaatcaaccccattcttctagccaagtcagtctgggtttt
gatcagatagtagatgagatcagtggcaaaattccacactgcgagagtgaaattgatgaa
aacaccttttttgtgcccactgcaccaaaatgggactcaacagggcattcattaaatgaa
gcacaccaaatatccttgaatgaattcacttctaaaagccacgaactctcctggcatcaa
gttaggaaagcaccagcaattggttttagtccttctatgttaccaaaacctcaaaatatg
aataaagaatgctcctggggaagccccataggaaaacatcatggtgctgatgattccaga
ttcagtattttagctccatcattcacaagtttggataaaattaatctagagaaagaatta
gaaaatgaaaatcataactaccatataggatttgaaagtagcattcctccaacaaattca
tccttctcaagtgacttcatgccaaaagaagagaataaaaggagtggacatgtgaacatt
gtggaaccatctttgatacttttgcaaggctctcttcaacccggaatgtgggaaagtaca
tggcggaagaatatagagtcaataggttgttccattcagctagtggaagtacctcaaagc
agcaatacgagtctggcctctttctgcaacaaagtaaaaaaaatcagagaaggatatcat
gcagctgatgttagtttcaattctgggaagatctggagcactactacagcatttccatat
cagctcttttctaagaccaagtttaatatacatatttttatagataactcaacacaacct
cttcattttatgccatgtgctaattatcttgtcaaagatctaattgcagaaattctgcat
ttttgcacaaatgaccacctactccccaaagatcatattctaagtgtatgtggctctgaa
gaatttttacaaaacgaccactgtttggggagccacaaaatgtttcaaaaagataaatct
gttattcagctccacctgcagaaaagtagggaagctccaggaaagctatctcgaaagcat
gaagaggaccacagtcagttttatctgaaccaacttctagaatttatgcatatttggaaa
gtatccagacaatgtctcttaacactcatcagaaaatatgacttccacctgaaataccta
ttgaaaacccaggaaaacgtggataatattattgaagaagttaaaaaaatatgcagtgtt
ctagggtgtgtggaaaccaaacaaattacagatgcagtaaatgaactaagtctaattctt
cagagaaaagcagagaatttttatcaaagttcagagacttcagcaaaaggcttgatagag
aaggtaacaactgaactatccacatccgtctaccagctaatcaatgtctattgtaacagc
ttttatgcagattttcagcctgtaaatgtacctagatgcatttcctatctaaatccgggg
cttccttcccacctcagcttcacagtgtatgcagcacacaacattccagaaacctgggtg
cacagctacaaagcattttcttttacctgttggcttacatacgctggaaagaagctgtgc
caagtgagaaactacagaaatattccagtcaagaaatttttttttttcttggtcaactgg
aatgaaacgatcaattttccccttgaaataaagtcacttccaagggaatccatgctcact
gtaaaactgtttgggattgcctgtgcaaccaacaatgcaaatttactggcgtggacttgt
cttccactgtttccaaaagaaaaatccattctcgggtctatgctgttcagcatgacatta
cagagtgagcctcccgtagaaatgatagctccaggagtgtgggatgtaagtcagccatcc
ccggtgaccctgcagattgattttccagctactgggtgggagtatatgaaacctgattct
gaagagaatagaagtaatcttgaagagccactaaaggagtgtataaaacatattgccaga
ctttcacagaaacagactcccctactgctctctgaagaaaagaaaagatatttatggttt
tatcgcttctactgcaataatgaaaactgctcccttcctttagtcctgggtagtgcccct
ggatgggatgaaaggactgtttcagaaatgcataccattttgagaagatggacattttct
caacctttagaggctcttgggcttttgactttcagttttccagatcaagaaattcgtaaa
gtggcagttcaacagttagacaacctcttgaatgatgaactactggaatatctcccacag
ctagttcaggctgtcaagtttgaatggaaccttgagagtcctttagtgcaacttctactc
caccgctccttgcagagcatccaggttgcccatcgtctttactggctgctaaaaaatgca
gaaaatgaagcttattttaaaagctggtatcagaagctactagctgctctccaattctgt
gcaggtaaagccttgaatgatgagttttccaaggagcagaaacttatcaaaattctggga
gatattggggaaaaagtcaagtctgccagtgaccatcaaagacaggaggtactgaagaaa
gaaactggcagactagaagagttctttcaagatgtaaatacttgtcatcttcctctgaac
cctgccctatgtataaaagggattgatcacgatgcatgttcatattttacatctaatgct
ttgccattgaagattactttcatcaatgctaatccgatgggcaaaaacatcagcattatt
tttaaggctggagatgatcttcgtcaggatatgcttgttctgcagattattcaagtgatg
gacaatatttggctgcaggaaggcttggatatgcaaatgatcatttatagatgtctatcc
acaggaaaagaccaaggattggtgcagatggtacctgatgctgtgaccctagcaaagatt
catcgccattctggactgataggaccattgaaagaaaatacaattaaaaagtggttcagt
cagcacaaccacttaaaggcagattatgaaaaggccttgaggaactttttctactcctgt
gctggctggtgtgtggtaacattcatcctgggagtatgtgaccgtcacaatgataatatc
atgctgacaaagtcgggccacatgtttcatattgactttggaaaattcttaggtcatgca
caaacatttggagggataaaaagggaccgagctcctttcatttttacttcagagatggaa
tactttattacagagggtgggaaaaacccacagcattttcaagattttgtggaactttgc
tgtcatgcttataatattatcagaaagcacagccaactgctcttgaacctgctggaaatg
atgctatatgcaggactgcctgagctaagtggaattcaagacctgaaatatgtgtataat
aatcttcgtccacaagacacagacctggaagcaacaagtcattttaccaagaaaataaag
gaaagtctggagtgtttccctgttaaattgaataacttgatccacacacttgcacaaatg
tcagccataagccctgccaaatctacttcacagacttttcctcaggaatcctgtttgctg
agtacaactaggtcgattgaaagagcaacaattttagggttcagcaagaaatccagtaat
ctgtatctgatccaggtgacacacagcaacaacaaaacaagcctgatagaaaaatcattt
gagcagttttcaaaacttcacagccaacttcagaagcagtttgcatcactgactctccca
gagtttcctcattggtggcacctaccttttacaaattcagatcacagaagattcagagat
ctaaatcattacatggaacagatattaaatggatcacatgaagttacaaacagtgattgt
gtacttagctttttcctctctgaggctgtgcaacaaacagttgaagaatcatcacttgtg
tacctaggtgagaagtttccagacaagaagcctaaggtgcagttagtcatatcctacgag
gatgtgaagctgaccatactagtgaaacacatgaaaaacattcatctcccagatggctct
gcgcccagtgcacatgttgaattttatcttttaccatatcccagtgaagttcgtaggagg
aaaacaaaatctgttccaaaatgtacagaccccacttacaatgaaattgtagtatatgat
gaagtcacagagctccaaggacatgtcttaatgcttattgtgaagagtaaaactgtattt
gtgggagcaattaacatccgactctgtagtgtcccactcaatgaagaaaaatggtatcca
ttaggaaacagtataatttga

DBGET integrated database retrieval system