KEGG   Gorilla gorilla gorilla (western lowland gorilla): 109025233Help
Entry
109025233         CDS       T02442                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00564  Glycerophospholipid metabolism
ggo00565  Ether lipid metabolism
ggo00590  Arachidonic acid metabolism
ggo00591  Linoleic acid metabolism
ggo00592  alpha-Linolenic acid metabolism
ggo01100  Metabolic pathways
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04217  Necroptosis
ggo04270  Vascular smooth muscle contraction
ggo04370  VEGF signaling pathway
ggo04611  Platelet activation
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04724  Glutamatergic synapse
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04921  Oxytocin signaling pathway
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109025233 (PLA2G4D)
   00565 Ether lipid metabolism
    109025233 (PLA2G4D)
   00590 Arachidonic acid metabolism
    109025233 (PLA2G4D)
   00591 Linoleic acid metabolism
    109025233 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    109025233 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109025233 (PLA2G4D)
   04010 MAPK signaling pathway
    109025233 (PLA2G4D)
   04370 VEGF signaling pathway
    109025233 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    109025233 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109025233 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109025233 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    109025233 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    109025233 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109025233 (PLA2G4D)
   04913 Ovarian steroidogenesis
    109025233 (PLA2G4D)
   04921 Oxytocin signaling pathway
    109025233 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109025233 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    109025233 (PLA2G4D)
   04726 Serotonergic synapse
    109025233 (PLA2G4D)
   04730 Long-term depression
    109025233 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109025233 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    109025233 (PLA2G4D)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     109025233 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B
Motif
Other DBs
NCBI-GeneID: 109025233
NCBI-ProteinID: XP_030858200
Position
15
AA seq 818 aa AA seqDB search
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFHFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDVSEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVLVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSTSNGWNGDNSARYL
TVPLRPLNIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDAEWSQRDLEGPIRYAREHLTKSKLEVFSPERLASYRRELELRAEQGY
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGMALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYRSHKDFSTWADCQLDSMPSQLTPQEARLCLVDAGYFINTSCPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPLDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFER
LLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgtcacctgggggaccacctggccacccttaccagggggaggcctctacc
tgctggcagctcaccgtgagggtcctggaggcgcggaacctgcgctgggctgacctgttg
agtgaggccgacccttacgtgatcctacagctgtcgaccgcacctggaatgaagtttaag
accaagacgctcaccgacaccagtcatcctgtgtggaatgaggccttccatttccttatc
caaagtcaggtcaagaatgttctggagcttagcatctatgatgaggactcagtcacggag
gatgatatctgcttcaaggttctctatgacgtctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagtccccagggagaggaggagctggatgtggagttcctgatg
gaagaaacgtcagatcgcccagaaaacctcatcaccaacaaagtccttgtggctcgagag
ctgtcatgcctggatgtgcatctggacagcacagggagcaccgctgtggttgcagatcag
gacaagctggagctggagctggtgctgaaggggtcctatgaggacacacagacatccttc
ctgggcacagcctctgccttccgcttccactacatggcagccctagagacagagctgagc
gggcgcctgaggagctccacaagcaatggctggaatggggacaactcagctcggtacctc
actgtgcccctgaggcccttgaacattgggaaggaggtgactatggatgttcctgctcca
aatgccccaggagtgaggctgcagctgaaggcagagggctgccctgaggagctggccgtg
cacctgggcttcaatctctgtgcagaggagcaggccttcctgagcaggaggaagcaggtg
gtggccaaggccctgaagcaggccctgcagctggacagagacctgcaggaggatgaggta
cccgtcgtgggcatcatggccacaggaggaggtgcccgggccatgacctcgctctacggc
cacctattggccttgcagaagctgggcctcctagactgtgtgacctacttcagtggcatc
tctggctctacgtggacaatggcccacctgtacggggacgctgagtggtcgcagagggac
ctggagggacctatcagatacgcccgggagcacctgaccaagagcaagctggaggtcttt
tccccagagcgcctggcgagctaccgccgggagctggagctgcgggctgagcagggctac
cccacgacttttgtggacctgtgggcgctagtgctggagtccatgctgcacggccaggtg
atggatcagaagctgtcaggacagagagccgccctggaacggggtcagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagacactggacttcaaggagtgg
gttgagttctccccctatgaggtcggtttcctgaagtacggggccttcgtccctcctgag
ctcttcggctccgagttcttcatgggacggctgatgaggaggatcccggagccccggatc
tgctttctggaagccatctggagcaacattttctccctgaacctgctggacgcctggtat
gacctcaccagttctggggagtcctggaaacagcacatcaaggacaagaccaggagctta
gagaaggagcccctgaccacctcggggacctcctcgcggctggaggcctcgtggctgcag
ccaggcatggcgctggcccaggcatttaaaggcttcctgaccggcaggcccctccaccag
cgcagccccaacttcctccagggcctccagctgcaccaggactaccgtagccacaaagac
ttctccacctgggcagactgccagcttgactccatgcccagccagctgaccccccaggag
gcccggctctgcctggtggacgccggctacttcatcaacactagctgtccctccatgttc
cggccaggccgcaggctggacctcatcctctccttcgactactccctatctgcgcccttc
gaggcgctgcagcagacggagctgtactgccgggcccgggggctgcccttcccccgggtg
gaacccagccctctggaccagcaccagccaagggagtgccacctcttctcagaccccgcc
tgccccgaggccccaatcctgctgcacttcccgctggtcaatgcctccttcaaggaccac
tcagcccccggtgtccagcgcagccccgcagagctccagggtggccaagtggatctcacc
ggggccacctgcccctacaccctgtccaacatgacctacaaggaggaagacttcgagcgc
ctgctgcggctcagtgactacaacgtgcagaccagccagggtgccatcctgcaggccctg
aggaccgcgctgaagcaccggaccctagaggcgaggcctccaagggcacagacctga

DBGET integrated database retrieval system