KEGG   Gossypium hirsutum (upland cotton): 107886454Help
Entry
107886454         CDS       T04793                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107886454
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ghi03041]
    107886454
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107886454
Spliceosome [BR:ghi03041]
 Complex C
  Other components
   Step II factors
    107886454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 ABC_tran AAA_19 DUF2075 T2SSE Sigma54_activ_2 AAA_14 AAA_33 AAA_16 AAA_23 AAA_29 Helicase_RecD RsgA_GTPase FtsK_SpoIIIE ATPase_2 DAP3 PhoH Sigma54_activat MMR_HSR1 AAA_24 SRP54 NB-ARC
Motif
Other DBs
NCBI-GeneID: 107886454
NCBI-ProteinID: XP_016665905
UniProt: A0A1U8HIM2
Position
12
AA seq 700 aa AA seqDB search
MANLPIVQFEKKIVETVDQNPVVVIIGETGSGKSTQLSQMLHRKGYTNSGIVSVTQPRRV
AAVSVSRRVAQELGVRLGEEVGYAIRFEDRTSERTQIKYLTDGVLLRESLSNPELNQYSV
IILDEAHERSLNTDILLGLMKRLVRRRASNLKVLITSATLDGEKVSKFFSDCPLLTVPGK
LFPVEIFYSKERPISYLESSLKTAMDIHVREPEGDILIFMTGQDDIEKLVSKLEDKVRSL
EEGSCMDAIILPLHGSLPPEMQVRAFSPPPPNCRRFVVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPATGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSRVYHDDFLDVTVPE
IQRSSLAGSVLYLKSLDLPDIDILKFDFLDPPSTESLEDALKQLYLIDAIDENGSITSIG
RTMAELPLEPSLSRTLIEANEYGCLSQALTVAAMLSAETNLLPGRSKNNEKKRKYPPLEL
PDGSGFGDHIQLLQIYECWDENDYDIGWCKDYDLQVRGMMFVKEVRKQLSQIMQKIAKGS
SDVRVNQNQKRRQSYRNLRKALSIGFASQLAERMRHHNGFRTLGFKPQLVQVHPSSVLKP
DDDGLYPNYVVYHELIATSRPYMRNVCAVERQWVIPILEKLDKLDVRKLSGGGLGHVEEI
TEGNKSDLLKKEAVIVTAPEEQESKIQAARERFLARKGKK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcttccaatcgtgcaattcgagaagaagatagtagaaacagtggaccaaaat
ccagtggtggtgatcataggagagaccggttcgggaaagagcacgcagctctctcagatg
ctccaccgcaagggatacactaattccggaatcgtttccgtcactcagccccgtcgcgtc
gcagccgtatctgtttcgaggcgagttgcgcaggagcttggtgttcgacttggggaagaa
gtaggctatgctattcggtttgaagatagaacttccgaaagaacacaaatcaaatacctt
actgatggagtgcttcttcgagaaagtctgtcaaatccggaactgaatcagtattctgta
attattctggacgaggctcatgagaggagtttgaatacggatattttgctggggttgatg
aaacgcttggttagaagacgtgcatccaatttaaaagttctgatcacgtcagcaaccctt
gatggtgaaaaagtgtcaaagttcttttcagattgtcccttgttaactgtccctggaaaa
ttatttcctgtggaaatattctacagcaaggagcgacctataagctatcttgagtcttca
ctaaaaacagctatggatatacatgttcgggaaccagaaggtgacatcctaatattcatg
actggacaggatgatatagagaagttggtatcaaagctggaggataaagttcgaagtcta
gaggaaggctcctgcatggatgctatcattcttcctctccatggttcattgccacctgaa
atgcaggtgcgtgcattcagtcctccccctccaaactgtaggcgttttgttgttgccaca
aacatagctgaaacttctttgacagttgatggtgttgtgtatgttattgattctggttac
gtgaagcaacggcaatataacccagcaactggaatgtattcccttgatgttgttcaaatt
agcaaggtacaagctaatcaacgtgctggacgagccggaagaacacgtcccgggaagtgt
taccgtttatacccatccagggtttaccatgatgatttccttgatgtaacagttcctgaa
atacagcgatcttctcttgctggcagtgttctttatctaaagtcattggacctccctgat
attgatattctgaagtttgattttcttgaccccccttctaccgagtcattagaagatgct
ctaaagcaactatatctgattgatgccattgatgaaaatggatcgataactagtattggg
cgaacaatggccgagctcccattggaaccttcactttcgagaaccttaattgaggcaaat
gaatatggttgcttatcccaggctctgactgttgcagccatgttatcagccgaaacaaat
ttgcttcctggtcgaagcaagaataatgagaagaaaagaaaataccctcctttggaactt
cctgatggttctggttttggtgatcacatccagttgttacagatctatgaatgctgggat
gaaaatgattacgatattggttggtgcaaagattatgacttacaggtgcgaggaatgatg
tttgtcaaagaagttcgaaagcagttatcgcagataatgcagaagatagcaaaagggtcc
tcagatgtacgagtgaatcaaaatcagaaaagacgccagagttataggaatttgaggaag
gcattgtccattggctttgcaagtcagcttgctgagcggatgaggcatcataatggcttt
cgaacactgggttttaagccccaactagtgcaggtgcatccttcctctgtgctaaagcca
gatgatgatggattatatccaaattatgttgtctaccacgaacttattgctacctcacgc
ccatatatgcggaatgtgtgtgctgtagagcgtcaatgggtgataccaattttagagaaa
cttgacaaacttgatgtcaggaaattaagtggtggtggattgggtcatgtagaagagatt
actgagggaaacaagtcagacttgctgaagaaggaagctgtcatcgttacagctccagaa
gagcaggaaagtaaaattcaggcagcaagggaacgttttcttgctcgcaagggaaagaaa
tga

DBGET integrated database retrieval system