KEGG   Gossypium hirsutum (upland cotton): 107886971Help
Entry
107886971         CDS       T04793                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 3 isoform X1
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00562  Inositol phosphate metabolism
ghi01100  Metabolic pathways
ghi04070  Phosphatidylinositol signaling system
Module
ghi_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107886971
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107886971
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     107886971
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     107886971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Motif
Other DBs
NCBI-GeneID: 107886971
NCBI-ProteinID: XP_016666573
UniProt: A0A1U8HRJ2
Position
12
AA seq 319 aa AA seqDB search
MRIKGKNFDGEGGEEEEQKLVVGYALTLKKKKSFLQPEFERLACKKGILFVAIDVNLPLS
DQGPFDIILHKDYRQTHPEVIVIDPPYAIQHLHNRQSMLQDVVDLNLSDFHGRVGVPKQM
VIMKDTLSIPDEVAKAGLKLPLVAKPLVVDGSAKSHELFLACDWSSLSELEPPLVLQEFV
NHDGILFKIYIVGDAIKVVRRFSLSNVNQCQLAKVPGIFPFPRVSSAAASADDADLDPRV
AELPPRPLLERLSKELRHRLGLRLFNIDMIREHGTRDIFYVIDINYFPGYGKMPDYEVIF
TDFLLTFKKKKYRAISCED
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaggataaaggggaaaaactttgatggagaaggtggggaggaagaggaacagaagctt
gttgttgggtatgctttgacattgaagaagaaaaagagtttcttgcaacccgagtttgag
cgtttggcttgcaaaaaggggatattatttgtcgccattgatgtaaacctaccgttgtca
gaccagggtccttttgacattattttacacaaggactatcgacaaacacatccagaagta
attgttattgatcctccatatgcgatacaacatctacacaatcgccagtcaatgcttcag
gatgttgttgatttaaacttatcagacttccatggcagagttggtgttccaaaacaaatg
gttatcatgaaagatactctttccatccctgatgaagttgctaaagctgggctgaagtta
cccttagttgctaaaccactagtagtggatggaagtgccaagtcacacgagctgtttctt
gcatgtgattggtcctctctatctgaacttgagcctccattggtactacaagagtttgtg
aatcatgatggtattctttttaaaatttatatcgttggggatgcaattaaggttgtaagg
agattctctctgtccaatgtcaaccaatgtcagcttgcaaaagttcctggtatttttcct
tttccaagggtttcatcggctgctgcttctgctgatgatgcagatttggacccccgcgtt
gctgaacttcctccaaggcctttgctggagagactttcaaaggagctccgtcaccggctg
ggccttcgattgttcaatatagatatgatccgagagcatgggacaagagacatcttttat
gtgattgacattaactactttcctgggtatggcaaaatgcctgattatgaggtcattttt
acagattttctactgactttcaagaagaaaaagtacagggcgatcagttgtgaagactga

DBGET integrated database retrieval system