KEGG   Gossypium hirsutum (upland cotton): 107887276Help
Entry
107887276         CDS       T04793                                 

Definition
(RefSeq) fanconi-associated nuclease 1 homolog
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ghi03400]
    107887276
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     107887276
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     107887276
DNA repair and recombination proteins [BR:ghi03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     107887276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC HIRAN Sgf11
Motif
Other DBs
NCBI-GeneID: 107887276
NCBI-ProteinID: XP_016666954
UniProt: A0A1U8HUC3
Position
12
AA seq 951 aa AA seqDB search
MLTGRESLSRLIGKRRRFLPNLQSILSSPIRSSLNLLSDKNGGLTETESSKGKVEISSSD
LVTCPVCESKVRGEDYTINSHLDRCLSRRTKRKLTQRTLLELNFGCSQSKLQISSDESER
LLSSDLRKNCSDYEENVTRCFSKIDPREEKSHDQCRQLPHTESVKQIDVAGSAENPISDG
RANTMVYFSALSTDNEESRNHMDGTVDSISGMAIDTFIVGRKFSDEKEVNLGANISLLRD
PDNIKDSNAIKVLSASSACCKVLGYLPLELAQYLSPLIEKYCLSFEGYVISVPKRSLDAV
PIQIVCQNIIFNGKNGCDEFEALHLWQKALQVVEFAKNRPPNTTKYQQNFCLLLKEVLTS
SPHLFTKDEKKFIESFTSLSEDSQRLFVRLYTRKGPWFRLSTIMYPEICNPQQAVKELSA
TGYLYLFEDTTKLHDDEMKDLLSLLTVSELRDILCTLRKKCNHGSRKQNLIASLLSCYKG
GSCPVLQRLIWERTEICIRASPEAESLFWRAETLFFLNGEQDLSAFLLVDLRIVKYPTYN
CIILEQIFSNKSDLLAYEEAIEVAQVIDQSLDENNFELVLRCIMIADSRISCCPEKLIDS
TSPDLMAIFRSCFSASWVYSKVILLGISFLECERRYKDAIHLLRRLLDCFTCDARRGYWT
VRLSVDLEHIGCPNESLSVAEAGLLDPWVRAGSRMALQRRVLRLAKPPRRWKTPSFSESL
KRKIIEVHIQGRPLNCEAGRKSRFYGEDGEQCGVEQLALQYYATEGGWQGVHTESGIWMT
IFGLLMWDILFSDVPNVFRTRFQTAPLDMDTDHFYLARKSLIEPQLQKIHDGLAEEILKT
SWELHMGTACRGVNWDQHSLSDLRAAVSCIRGPCLASLCRHLAQDYRSWLSGMPDLLLWR
FHGDYKGEAKLVEVKGPRDQLSEQQRAWLLLLMDCGFNAEVCKVSPTVLSP
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgctaactggaagagaaagtttaagcagattgatcggcaagcgccgccgttttcttccc
aaccttcaatctattctctcttcgcctatccggagctctttgaatctattgtctgataaa
aatggaggcttgactgaaactgaatcttccaaaggcaaagttgaaatatccagttctgat
ttggtaacttgccctgtttgtgagagcaaagttcgtggtgaagattacactatcaattct
catctggacagatgtctttctagaagaaccaagcggaagctgacacagcggacacttctg
gaattaaactttggttgctctcagtcaaagcttcaaatttcctcggatgaatcagaacgg
ctgctgagtagtgaccttaggaagaattgttctgactatgaagagaatgtcactcgttgc
ttctcgaagattgatccaagagaagaaaaaagccatgatcagtgcagacaattgccgcat
actgagagtgttaaacaaattgatgtggctggttctgcagaaaatccaatcagtgatgga
agggcaaacaccatggtttacttttctgcattgtccactgataatgaggagtccagaaat
catatggatggaactgtggacagcatatctgggatggctattgatacttttatcgtcggt
cgtaagtttagtgatgaaaaagaggtgaatctaggggcaaacatatctcttctgagagac
cctgataatattaaggattcaaatgctatcaaggttctttctgcaagttctgcatgctgt
aaagtgcttggttatctccctctagagttagctcagtatttatctcctctgattgaaaag
tactgcttgagctttgaggggtatgtgatatctgttcctaaacgttctcttgatgctgtt
ccaattcagattgtgtgtcagaacattatatttaatggtaaaaacggatgtgatgaattt
gaggctttacatttgtggcaaaaagctcttcaagtagttgaatttgcaaagaaccgccca
cctaatacgacaaaatatcagcaaaatttttgtttgttactgaaggaggttctaactagt
agccctcaccttttcacaaaagatgaaaagaaattcatcgaatcattcacttcattatca
gaggatagtcagaggctttttgttcgactttatacacggaaaggaccttggtttcgattg
tctaccattatgtaccctgaaatatgtaatcctcaacaagctgtcaaggagctgtctgca
actggctatctgtatctctttgaagatacaactaaactacatgatgatgaaatgaaggac
cttttgagtctgctcactgtttctgagcttcgtgacattttatgtacacttagaaagaaa
tgtaatcacggatcaagaaagcaaaatcttattgcatctcttctttcctgctataaaggt
ggatcatgccctgttctacaacggttaatttgggagagaaccgagatttgtattagggca
tctccagaagctgaatcccttttttggcgtgctgagacgcttttcttcctaaatggagaa
caggatctgtcggcattcctactggtggatctcaggattgtcaagtatcctacttacaac
tgcataattttagaacagattttctcgaataaaagtgacttacttgcatatgaagaggcc
attgaagtggctcaagtaattgatcagtctcttgatgaaaacaactttgagttggtttta
agatgcatcatgatagctgattcccgtatatcctgctgtcccgagaaattgattgattcc
acaagtcctgatttaatggctatatttcgatcatgcttctcagcatcatgggtgtattct
aaagtaatcttgcttggaatttccttccttgagtgtgagcgtaggtacaaggatgcgata
catttactaaggcgattgcttgattgcttcacctgtgatgcaagaaggggatattggacc
gtaagattatctgttgatttggagcatattggctgccccaatgagagtctttcagtcgct
gaggctggattattagatccttgggttcgtgccggttcaagaatggcactacaaaggcga
gttcttcgcttggcaaaaccacctaggcgctggaaaactccaagtttttcagaatctctt
aagaggaagataatagaggttcatattcaagggagaccattgaactgtgaagctggtaga
aaaagccggttctatggggaagatggggagcaatgtggagtagaacagttagctctacag
tattatgcaacagaaggtggatggcagggtgtccatacagagagtggtatatggatgact
atcttcgggcttctcatgtgggatattttattttcagatgtaccaaatgttttccgcacc
agattccagactgctccattggatatggatactgatcatttttatctggcaagaaagagc
cttatcgagccccaactacaaaaaatccacgatggtttggctgaagagattctcaaaaca
tcatgggaattgcatatgggaacagcttgtagaggagttaattgggaccaacactccctt
tccgaccttcgagcagctgtttcatgtatcagaggtccttgtttggcctctctatgtaga
catctcgctcaggattaccgcagttggttgagtggaatgcctgatttgttgctctggcgg
ttccatggggactacaaaggtgaagccaaactcgtcgaggttaagggccctagagatcaa
ctctccgaacaacaaagagcatggctgctgcttctaatggattgtggattcaatgcggag
gtttgtaaagtgagccctacagtattatccccttga

DBGET integrated database retrieval system