KEGG   Gossypium hirsutum (upland cotton): 107888290Help
Entry
107888290         CDS       T04793                                 

Definition
(RefSeq) protein HASTY 1-like
  KO
K14289  exportin-5
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107888290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ghi03016]
    107888290
   03036 Chromosome and associated proteins [BR:ghi03036]
    107888290
Transfer RNA biogenesis [BR:ghi03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    107888290
Chromosome and associated proteins [BR:ghi03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     107888290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 107888290
NCBI-ProteinID: XP_016667842
UniProt: A0A1U8HP82
Position
13
AA seq 1206 aa AA seqDB search
MEESNSNNSTVNNVARAIVAALDWNSTPDARKAAVSYLESIKAGDIRVLANTSFLLVKKD
WSSEIRLHAFKMLQHLVRLRWEEFSLSERRNFSNVAVELMSEIADPCEEWALKSQTAALV
AEVVRREGLNLWQELFPSLVSLSSKGPVQAELVSMMLRWLPEDITVHNEDLEGDRRRLLL
RGLTQSLPEILPLLYTLLERHFGEALSEVGRQHLDIAKQHAAAVTATLNAINAYAEWAPL
SDLAKFGIIHGCGFLLSSPDFRLHACEFFKLVSPRKRPADDFASEFDSAMSSIFQILMNV
SREFLVRSNSAGGAIDESDFEFAEYVCESMVSLGSSNLQCILRDSSTSALYLQQMLGFFQ
HFKLALHYQSLQFWLALMRDLMSKPKLSVHSSGEGSAASNTDSNSAQVDNEKRKILSFLN
DDICSTILDISFQRMLKKERLITGKALSLGALELWSDDFEGKGDFGQYRSRLFELIKFIA
SNKPLVAGAKVSERIIMIIKNLLNSPMPAEDLAVMESMQVALESVVSSIFDGSNEFAGGS
SEVHVALCGIFEGLLRELLSLNWTEPALVEVLGHYLDAMGPFLKYFSDVVGSVINKLFEL
LNSLPFVVKDPSTSSARHARLQICTSFIRIAKAADKSILPHMKGIADTMVYLQREGRLLR
GEHNLLGEAFLVIASAAGVQQQQEVLAWLLEPLSQQWIQIEWQNNYLSEPLGLVRLCSET
AFMWSLFHTITFFEKALKRSGMRKGQSSSTSSSTPHPMASHLSWMLPPLLKLLRAIHSLW
SPSVFQVLPGEIKAAMSMSDVERSSLLGVGNPKLSKGALTFIEGSPFDVNKEGYTEPNEA
DIRNWLKGIRDSGYNVLGLSATIGDPFFKGIDVDSVALALIENIQSMEFRHTRQLVHSVL
IPLVKSCPPDMWGVWLEKLLHPLFVHCQQALSCSWFGLLHEGRAKVPDNHGILTGSDLKV
EVMEEKLLRDLTREICLLLSTIASPGLNTSLPALEHSGHVGRVDMSSLKDLDAFAPSSMV
GFLLKHKSLAIPVLQISLEAFTWTDSEAVTKVCSFSASVVLLAILTNNVDLREFVSRDLF
SALIRGLALESNAFISADLVNLCREIFIYLCDRDPAPRQILLSLPCITPNDLHAFEEALT
KTASPKEQKQHMRSLLLLATGNNLKALAAQKNVNIITNVTARPRGPVNAPGNGIEEGDSV
GLAAIL
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagtaacagtaacaatagcacagtaaacaatgtggctagagccatcgttgca
gcccttgattggaactctactcctgatgctcgcaaagctgccgtttcttaccttgaatct
attaaagcaggagatatacgggttttggcaaacacatcattcttattagttaaaaaggat
tggtcttcagaaatacgattacatgcatttaaaatgctacagcacttggttcgattgcgg
tgggaggaattcagtctctcagaacgtaggaacttttcaaacgttgctgttgagttaatg
tctgaaattgcagatccttgtgaggaatgggctttgaaaagtcaaacggctgccctagtt
gctgaggtagttagaagagaaggactaaatctttggcaagagctgtttccatcgctagtt
tccctatccagcaagggccctgttcaagctgagttggtctcaatgatgctgagatggctt
cctgaagatattacagtccacaatgaagatttggaaggtgatcggcgtagattactgtta
cgtgggcttactcaatctttgccagaaattttgccactactatacacattattggaaagg
catttcggggaagcattgagtgaggtgggtagacaacatcttgacatagcaaaacagcat
gcggctgctgtaacagctactttaaatgccataaatgcctatgccgaatgggcacctttg
tctgatcttgctaaattcggcatcattcatgggtgtggtttcctactttcttctcctgat
tttcgccttcatgcttgtgagtttttcaaactagtctctccaagaaagagacctgctgac
gactttgcttctgaatttgattctgcaatgagtagcatctttcaaatcttgatgaatgta
tctcgggaattcttggtcagatctaactcagcaggtggggcaatagatgaaagtgacttt
gagtttgcagaatatgtttgtgaaagtatggtatctttgggttcctcaaacttgcaatgt
attctcagagacagcagtacgtccgctctctacttacagcagatgcttgggttctttcaa
cattttaagctagctcttcattatcaatccctgcaattttggttggcactgatgcgggat
ttgatgtcaaagccgaagctttcagtgcattcatctggagaagggtcagctgctagcaat
acagactcaaattcagctcaggttgacaatgaaaagagaaagattttaagttttctcaat
gatgatatttgtagtacgattctggatatatcattccaacgcatgcttaagaaagaaagg
cttatcactggaaaagccctttctctaggggctttggagttgtggagtgatgactttgaa
ggaaagggtgatttcggccagtaccgttctagacttttcgagttaatcaagtttattgct
tcaaacaagccccttgtggctggtgctaaagtttccgaaagaattattatgatcattaag
aacctcttgaactctccaatgcctgctgaggacttagcagtgatggaaagcatgcaagta
gctctggaaagtgttgttagctctatttttgatggttcaaatgagtttgcggggggtagt
tcagaagttcacgttgctttatgtggaatatttgaaggtttacttcgggaacttctttca
ttgaattggactgagcctgcccttgtggaagtacttgggcactatctagatgcaatgggt
cccttcctgaagtatttctcggatgtagttggtagtgtcatcaataagctatttgagctc
ctaaattcacttccttttgttgttaaggatccttcgacgagcagtgcacggcatgcaagg
ttgcaaatttgtacatcatttattcggatagccaaagctgctgacaaaagtattctgcct
cacatgaagggtattgctgataccatggtgtatttgcaaagagaaggccgtctgcttcgc
ggtgaacataatcttctaggtgaagcatttcttgttatagcatctgctgcaggggttcaa
cagcagcaagaagttttggcatggttacttgaacccttgagccaacaatggatacaaata
gaatggcaaaacaattacttgtccgaacctcttggactagttcgtttatgctccgagaca
gcatttatgtggtcactgttccacactatcacattctttgagaaagcactcaagaggagt
ggaatgaggaaaggccaaagcagctcaacatcaagttctaccccacatccaatggcttct
catctgtcttggatgcttcctcccctcttaaaactgcttcgtgctatacattccctttgg
tcaccatcagtattccaagtattacctggggagattaaagcagcaatgagcatgagtgat
gtggagcggtctagtcttcttggcgttgggaaccccaaattgtcaaagggggcattaact
ttcatagagggatctccatttgatgtgaataaggaagggtatactgaaccaaatgaagct
gatatacggaattggttaaagggtatcagagacagtgggtacaatgtattgggactatct
gcaaccattggagatccgtttttcaaaggcattgatgttgattctgttgctttagctcta
attgagaatatacagtcaatggagttcagacatacaaggcagcttgttcattctgttttg
attcctttggttaagtcttgtcctcccgacatgtggggggtatggctggaaaagctactg
cacccgttatttgtccactgtcagcaagctctgagctgttcatggtttggtcttctgcat
gaaggccgggcgaaggttcccgataatcatggtatccttactgggtcagacttgaaagtg
gaagtaatggaagagaagttactccgagatttaactcgtgagatatgtttgctcctttct
actatagcgtcacctggattaaacactagccttcctgctttagaacattcggggcatgtt
ggtcgcgtggacatgtcttctcttaaagatttggatgcatttgcaccaagctctatggtt
ggtttccttttgaagcacaaaagcctggcaattccagtactccaaatatcgttagaagca
tttacttggacagacagtgaagctgtgaccaaagtttgttctttctctgcttctgtggtt
cttctagctatacttacgaacaatgtcgatctccgggaatttgtttcgagagatctattt
tctgctctcatccgaggtctagccctcgagtcaaatgcttttatcagcgctgatctggtt
aacctctgtcgcgaaatattcatttatctctgtgacagagatccggctcccagacagatt
ttactttccctcccttgtattaccccaaacgatttacatgcctttgaagaagccttgaca
aagaccgcaagtccgaaagaacaaaagcagcatatgagaagcttgcttttattagctact
gggaacaacctaaaagctcttgctgctcagaaaaatgtaaacattattacaaacgttact
gcgcggccacgtggtccagtcaatgctccaggaaatggaatcgaggagggcgacagcgtg
ggcttggcagctatactgtga

DBGET integrated database retrieval system