KEGG   Gossypium hirsutum (upland cotton): 107889605Help
Entry
107889605         CDS       T04793                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00260  Glycine, serine and threonine metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107889605
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     107889605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 107889605
NCBI-ProteinID: XP_016669580
UniProt: A0A1U8HU86
Position
2
AA seq 417 aa AA seqDB search
MFFNGFLDFSNFLSLFFFNGWSFLETSSTCHGINSQIIWISTLNSSTMVARTVDLRSDTV
TKPTETMRAAMATAEVDDDVLGADPTAFRLESEVAKITGKEAGLFVSSGTMGNLISVLVH
CDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDIDSIEVAIRDPRGELV
FPTTKLICLENSHANSGGRCLSAEYTDRVGELAKKNGLKLHIDGARIFNASVALGVPVQR
LVQAADSVSVCLSKGLGAPVGSVIVGSKSFITKARRLRKTLGGGMRQVGFICAAAFVALK
ENVEKLDGDHKKAKELAEGLTQIKGLKVDVAAVETNIIYVDIVEGSKITAEKLYKNLEEH
GVLVMPKGLSRMRIVLHHQISSSDVHYTLSCFQQAFTGMRQEIGSYSISTSRDVSYA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttctttaatgggtttttagatttctccaatttcctttctcttttcttttttaacgga
tggagtttccttgagactagttcaacatgtcatgggataaattcacaaattatatggatt
tcgacactaaattcatcaacaatggtggctagaacagtggatcttcgatctgatacagta
acaaaaccaacagagacaatgagggctgcaatggccactgctgaagttgatgatgatgtc
ttgggagctgatccaactgcgttccggttagaatcggaggtcgccaagatcacgggcaag
gaagccggtctatttgtctcatcaggcaccatgggtaacctcataagtgttctagttcat
tgtgatataagaggaagtgaagtcattcttggtgacaattctcatatccatatttatgag
aatggtggtatttcaacaattggaggtgtacatccaaggccagtcaagaacaatgaagat
ggaacaatggatatcgattcaatcgaagtcgctattagagatccgagaggagagcttgtg
ttcccaactacgaagttgatttgcttggagaattcacatgccaactccggtggtagatgc
ttgtctgcggaatacaccgacagagttggagagctggctaagaagaacggcttgaagctt
cacatcgacggggctcgcattttcaatgcatcagtggcacttggagttccagttcagagg
cttgtacaagctgcggattctgtctcggtgtgtctatcaaaaggtttgggtgctccggtt
ggatcagtcattgttggttcgaaaagcttcattaccaaggctaggagacttcggaaaacc
ttaggtggtgggatgaggcaggttggcttcatctgcgctgccgcttttgttgctttgaaa
gagaatgttgaaaagcttgatggtgatcacaagaaggcaaaggagttagcagagggccta
actcaaatcaaaggtctaaaagtggatgttgctgcagtggaaaccaatattatatatgtt
gacatagtggagggctcaaaaatcacagcagagaaactatacaagaatttagaggaacat
ggtgtacttgtaatgccaaagggcctatccaggatgcgaattgtcctccaccaccaaatt
tcatcaagtgatgtgcactacactttgtcatgctttcagcaagctttcactggtatgcgc
caagaaatcgggagctactctatatcaacgtctcgggatgtttcatacgcgtaa

DBGET integrated database retrieval system