KEGG   Gossypium hirsutum (upland cotton): 107890437Help
Entry
107890437         CDS       T04793                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00510  N-Glycan biosynthesis
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107890437
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ghi01003]
    107890437
Enzymes [BR:ghi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     107890437
Glycosyltransferases [BR:ghi01003]
 Glycan extension
  N-Glycan
   107890437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 107890437
NCBI-ProteinID: XP_016670343
UniProt: A0A1U8I2A3
Position
2
AA seq 421 aa AA seqDB search
MANYKKPRFKDAAFKRFLSVVLGTLLLVSLLVVSLGTNATPGSSGLDEGLSESVVNIQSF
REKLNLPKENDFSIRLEKQNRLPPRNIDLYPRLAKDHITIVLYVHNRPQYLRVVVNSLSK
VVGISETLLIVSHDGYFEEMNKIVEGIKFCRLKQIFAPYSPHVFTDSFPGVSSKDCQEKX
DAGKKHCVGNPDQYGNHRSPNIVSLKHHWWWMMNTVWDGLKETRGHDGHILFIEEDHFIY
PNAYCNLQLLVSLKPNKCPDCYAANLAPCDVNLRGEGRNSLVAERMGNVGYAFNRTVWRK
IHGKAKEFCFFDDYNWDITMWATVYPSFGSPVYTLRGPRTSAVHFGKCGLHQGQGKANAC
IDNESVNVQVDDTDKVANIRPEWDVKVYQNQPGYKAGFKGWGGWGDNRDHRLCLNFAQMY
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctaattacaagaaaccccgtttcaaagatgcagcttttaaacgtttcctctctgta
gttttaggtactctactactggtttcacttttggtagtttctcttgggaccaatgcaacg
ccaggttcaagtggattagatgaaggtttaagtgaaagtgttgttaatattcagagtttt
agggaaaaactcaaccttcctaaagagaatgatttttcaattcgattggagaaacaaaac
cggttgccccctaggaatatagatctatatccaaggttagccaaagatcatataaccatt
gttttatacgtgcataatcgccctcaatatctccgagtagttgttaatagcttgtcgaag
gttgtggggataagtgaaactttattaattgtcagccatgatggatactttgaagaaatg
aacaagattgtggaagggatcaaattttgccgattgaaacagatctttgccccttattcg
ccccatgtatttactgacagttttcctggtgtgtcgtcgaaggactgtcaagaaaaanat
gatgctgggaagaaacattgtgttgggaatccagatcagtatggaaaccaccggtctcca
aatatagtttctttgaagcatcattggtggtggatgatgaacactgtgtgggatggattg
aaggagactagagggcatgatggacatattcttttcatagaggaggaccacttcatttac
cccaatgcgtattgcaacttacagcttcttgtatcactgaagcctaacaaatgcccagat
tgctatgctgcaaatctggcaccctgtgatgtgaatttaagaggagaaggacggaatagt
ttggttgctgagagaatgggaaatgtgggttatgccttcaaccggactgtatggagaaaa
atccatgggaaggctaaagagttctgcttctttgatgattacaattgggatataacaatg
tgggcaaccgtctatccttcgtttggtagtccagtgtacacgttacgaggtccaaggact
agtgcagttcactttgggaagtgtggtttgcatcagggccaagggaaggctaatgcttgc
attgataatgaatcagtgaacgttcaagtagatgacactgataaggttgctaatatcaga
ccagaatgggatgttaaagtatatcagaatcaaccagggtataaagctgggtttaagggt
tggggtggctggggggataatagagatcaccgattgtgcttgaattttgctcaaatgtac
cattaa

DBGET integrated database retrieval system