KEGG   Gossypium hirsutum (upland cotton): 107890583Help
Entry
107890583         CDS       T04793                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00906  Carotenoid biosynthesis
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Module
ghi_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    107890583
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     107890583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 107890583
NCBI-ProteinID: XP_016670575
UniProt: A0A1U8HX44
Position
14
AA seq 602 aa AA seqDB search
MQPSLHFFTPKHQSLLQTQSPLFTCKFIVNPAKKTVPRNPSPLLSPPAPSRSPPHPEVVE
PMVQRERSNVLVPQHPNYPVHLNRFQKLAAVALDKIETSVIMRLEKNYVLPKMVDPEVQI
SGNFAPVEECPVHHGLEVVGRIPACLRGVYVRNGANPMFAPSGGHHLFDGDGMIHAVSLG
LGNKASYSCRYTRTSRLVQEARFGRCMFPKPIGELHGHLGLARLGLYMARAGLGLVDGSH
GTGVANAGLVYFNGRLLAMSEDDLPYHVKITGEGDLETIGRFNFSDQIDCPLIAHPKLDP
VTGDLHTLNYNVLKKPYLKYFRFDKFGRKSGDLHVDIDQATMIHDFAITENFVVIPEHQM
VFKLSEMIRGGSPVVYNKNKTSRFGVLQQNDVVGSGIQWINVPNCFCFHLWNAWEEISDT
GDKIIVVIGSCMNPPDSIFNESKDTFRSELSEIRMNLRTRQSTQRVIVSGMNLEAGQVNG
QYLGQKTRFVYLAIADPWPKCSGIAKVDLQTGKVTKFMYGTWRYGGEPFFVPDKKQTCNR
NGNEDEGYIMGLVRDEKKEMSEMVIVKGSNMEQVAAIRLPSRVPYGFHGTFISQEELRRQ
VI
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccctcacttcacttctttacccccaaacatcaatctctccttcaaacccaatcc
ccattatttacatgcaagtttatcgtcaatcccgccaagaaaaccgttcctcgaaatccg
tcaccattgctatcaccgccggcgccgtcacgatcacctcctcatcccgaggttgttgaa
cctatggtccaacgagaacgtagtaatgtcttggttccacaacacccgaactatccggtt
catttaaaccgatttcaaaagctagcggcggtggctttggacaaaattgagacctccgtg
atcatgcgacttgaaaaaaattatgtgttgcctaaaatggttgacccggaggttcaaatt
tcagggaactttgcaccggttgaagagtgtccggtccatcacgggttggaagtggtcggt
cggattccagcttgcttacgcggcgtatacgtccgaaacggtgcaaaccctatgtttgca
ccctcaggtgggcaccatttgtttgacggtgatgggatgatccatgccgttagcttgggg
cttggaaataaagctagttatagttgcaggtatactcgaaccagccgattggttcaagaa
gcccggttcggtcggtgcatgttccccaaaccaattggtgagctgcatggacacttgggt
ttagctagactcggtctgtacatggctcgagccggtttaggcttagttgacggttcacac
ggcacgggtgtagcaaatgcagggcttgtttatttcaatggtagactgttagccatgtcc
gaagatgatcttccttatcacgttaaaatcaccggcgagggtgatcttgagacgattgga
cggttcaacttcagtgatcaaatcgattgcccgttgatcgctcacccaaaactagaccca
gtcacaggtgatttgcacaccctgaattacaacgttctaaagaaaccttacttgaaatac
ttcaggttcgataaattcggaaggaagtcaggtgacttgcacgtggacatcgaccaggca
acaatgattcacgactttgccataaccgagaatttcgtagtaatcccggaacaccaaatg
gtattcaagttatccgaaatgattcggggcggatcacccgttgtatacaacaaaaacaag
acatcccgattcggtgtattgcaacaaaacgatgttgtcgggtcggggatccagtggatc
aacgtaccgaattgcttctgtttccatttatggaatgcatgggaagaaatatccgacacc
ggtgataaaatcatagtagtaatcgggtcctgtatgaacccgcccgattccattttcaac
gaatcgaaagacacgttccgaagtgaactatccgaaatccgaatgaacttaagaacaaga
cagtcaacacaaagggtaattgtatcagggatgaacctggaagcgggtcaagtgaacgga
caatacctgggtcaaaagacccggttcgtgtatttggcaatagcggatccatggccaaag
tgttcgggcatagcaaaagtagatttgcagacaggtaaagtcaccaagttcatgtacgga
acatggcgttatgggggtgaaccattttttgtgcccgacaaaaaacaaacgtgtaacaga
aacggtaatgaagatgaaggatatataatgggattggtgagagatgagaagaaggaaatg
tcggagatggtgatagtgaaaggttcgaacatggaacaagtggctgctataaggttgcct
agtagggttccttatggattccatggcacctttattagtcaagaagagctacgtcgtcaa
gtcatctga

DBGET integrated database retrieval system