KEGG   Gossypium hirsutum (upland cotton): 107890919Help
Entry
107890919         CDS       T04793                                 

Definition
(RefSeq) polygalacturonase-like
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00040  Pentose and glucuronate interconversions
ghi01100  Metabolic pathways
Module
ghi_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107890919
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     107890919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3 Beta_helix DUF2258 NosD
Motif
Other DBs
NCBI-GeneID: 107890919
NCBI-ProteinID: XP_016671016
UniProt: A0A1U8HYC4
Position
14
AA seq 393 aa AA seqDB search
MEQAAKSIVFLAFVLLFFPSSGVADPLTYNVLNYGAKPDDNFDSTQALVAAWTLACGSIN
PATIYVPPGRFLVRNVVFRGQCKNNGIVFRIDGTLVAPSDYKVIGSTGNWLFFEHVNGVS
IYGGILDGQGTGLWTCKRSGKGCPSGATSLGFSNSRNIVIRGLTSLNSQMYHIVINGCNN
VKVEGVRVSASGNSPNTDGIHVQSSSGVTILNTRIGTGDDCVSVGPGTNNLWIEKVACGP
GHGISIGSLGKEVEEAGVQNVTVKTVAFTGTENGVRIKSWGRQSSGFARNILFQHAVMTD
VQNPIVIDQQYCPDEKNCPGQVSGVKISDVTYQDIHGTSATEVAVKFDCSSEYPCSNIRL
EDVKLTYRNKAAEASCSNADGTASGFVQPSSCL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggcagccaaatctattgtttttcttgcatttgttctacttttcttcccttca
tctggggtagctgatccattgacttataacgttcttaactatggagccaaacccgatgac
aattttgactcaacccaagccttggttgctgcatggactttggcctgtggctccatcaat
cccgcaactatttacgtcccgcctgggaggtttttggtgcgcaatgttgtttttcgtgga
cagtgcaagaacaatggtattgtttttcgtatcgatggcacgcttgttgctccatcggat
tataaggttattggaagtaccggaaactggcttttctttgagcatgtaaacggtgtttcg
atttacggtgggatacttgatggtcagggcactggcttatggacttgcaagaggtcaggc
aaaggctgtcccagcggggcaacgtccttaggcttcagcaattcgcggaacattgtaata
agaggattaacatcgctaaacagccaaatgtatcatattgtcatcaatggttgtaacaac
gtaaaagtggaaggtgtaagagtgtcagcctctgggaatagcccaaacaccgatggcatt
catgtgcaatcatcgagcggcgtcaccattctgaacaccagaatcggaacaggcgatgat
tgtgtctcggttgggcccggcaccaacaatttatggattgagaaggtggcatgtggacct
ggccatgggatcagcattgggagtcttgggaaggaagttgaagaagctggtgtgcagaat
gtgactgttaaaacagttgcatttactggcactgaaaatggggtgagaataaagtcatgg
gggagacaaagctctggttttgctaggaacatactttttcagcatgcagtcatgaccgat
gtccaaaaccccatcgtcattgatcaacagtactgcccagatgaaaagaactgccctggt
caggtttcgggagtaaaaattagcgatgtgacataccaagacatccatggaacatcagcg
acagaagtagcagtgaagtttgattgtagctcagaatatccttgcagtaatataaggctg
gaggacgtgaagctcacttacagaaacaaagcagctgaagcatcctgtagtaatgctgat
ggaaccgcttctggttttgttcagccctcaagctgcttgtag

DBGET integrated database retrieval system