KEGG   Gossypium hirsutum (upland cotton): 107897518Help
Entry
107897518         CDS       T04793                                 

Definition
(RefSeq) wall-associated receptor kinase-like 14
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107897518
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107897518
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107897518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase EGF_3 RANK_CRD_2
Motif
Other DBs
NCBI-GeneID: 107897518
NCBI-ProteinID: XP_016678493
UniProt: A0A1U8IRH6
Position
16
AA seq 693 aa AA seqDB search
MVALFSSWRNQMILCPAKLWFSITVIVLFLSSRAKSVHSEKNKCHGSCVTNNFTTPLPYP
FGFSSGCPIRLRCTRSGVRIGGFHVLNVTSTYIIVGLPTKCDRQVSSINALFGENYAVST
SNNLLLQSCSKPIEAPCEIRPKFLEPSFNLNPCVSKGGNISCFAGNPGEKLLSFEEVNGT
QCRFVLSSTSFVVDSARNSSISLELDRVNLEWWMKGQPDCDRNANYEPVKTGNTTVGFKC
FCKDGFEGDGFRAGDGCRRVSKCNASKYMSGKCGGTTRVVVLIGGLAVGALLMGGVALLC
CYIRRRTNSINKRMNAKRLIYEAAGNSSVPFYAYREIEKATNGFSDKQRLGIGAYGAVYS
GKLQNVDWVAIKRFRFRDPASIDQVMNEIKLLSSVSHPNLVRLLGCCIEEGEPILVYEFM
PNGTLLQHLQRERGEGLPWTVRLTIAAETAKAIAYLHSVNPPIFHRDIKSSNILLDYNYR
SKVADFGLSRLGMTESSHISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLVEIITAL
KVVDFARQHSEVNLAALASDRIGRGCIDEIIDPFLDPHKDAWTMSSIHNVAELAFRCLAF
HGDMRPSMSEVAEELEHIRFSAWVPSLSPSASSYSSSDNESEKCLSTKMGSQRLVVKQRE
EDHSSPVSVQEYWLSGESSPSTNSLLGNASQRE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggttgctctgttttcttcttggagaaaccaaatgatattgtgtccagcaaaattatgg
ttttcaataacagtaatagttctttttcttagctcccgagcaaaatctgttcattcagag
aagaataagtgccatggctcttgcgtaaccaacaatttcacaacacccttgccgtatcca
ttcggattctcatcgggttgccccatccgactcagatgcacccgaagcggtgttaggatc
ggaggctttcatgtcctcaacgtgacttccacatacatcatcgtcggccttcccaccaaa
tgcgaccgacaggtttcttcgatcaatgctttgttcggagaaaactacgccgtttcaact
tccaacaatcttctgctacaaagctgttcgaaacccatagaagctccatgtgaaataagg
cccaagtttttagaaccatcattcaatctcaacccttgtgtttctaagggcggcaacata
agttgcttcgccggcaatcctggtgagaagttgttgagtttcgaggaagttaatggaacg
cagtgccgtttcgtgctttcctcgacttcatttgtggttgactcggcgaggaactcatcg
atttctttggaactcgatcgagttaacttggaatggtggatgaaggggcagcctgattgt
gatagaaatgctaattatgagcctgtcaagactggtaatacgacggtggggtttaagtgc
ttttgcaaagacgggtttgaaggagatggcttccgagctggcgatggctgccggagagtt
tctaaatgcaatgcttcaaaatacatgtctggcaaatgcgggggaactacaagagttgtt
gttcttattggagggcttgcggttggggctttgttgatgggtggggtggctcttttatgt
tgctatattcgaaggcgaactaattcgataaacaaacggatgaatgcaaagcggcttata
tatgaagcagccggcaattctagtgttcctttctatgcctatagagaaattgaaaaagct
acaaatggtttctctgataaacaaagactagggattggagcctatggtgcagtttattca
gggaaactccaaaatgttgattgggttgccataaaaaggttcaggtttagagaccctgct
agcattgatcaagtaatgaatgagatcaagctcctttcatcggtcagccacccgaatctt
gttcgtctcttaggttgctgcattgaggaaggcgaaccgatcctggtttatgaatttatg
ccaaatggaactttattgcagcatctgcaacgagagaggggtgaaggacttccatggaca
gtaaggcttaccattgctgctgaaactgccaaagctattgcttatcttcactctgtgaat
cccccaatttttcatagagatataaagtctagcaacatactattggattataattataga
tcaaaggtggctgattttggcctttcaaggctggggatgacagaatcatcccacatctcc
actgccccacaaggaacaccaggttatctcgatccgcaataccatcagtacttccatctt
tcggataaaagtgatgtttatagtttcggggttgttctcgtggagataataactgcattg
aaagtggtcgatttcgcccggcagcatagcgaggtaaacttggctgcacttgctagtgat
aggataggaagaggctgcatcgatgagataatcgatccttttcttgacccacacaaggat
gcttggacaatgtcatcaatccataatgtggctgagctagcatttagatgccttgctttt
catggtgacatgaggcctagcatgtcggaagtggccgaagagctagaacacatccggttt
agcgcctgggttcccagcttgtcaccatcggcttcctcttattcatcgtcagataatgag
agtgaaaaatgtttaagtacaaagatgggaagccagagattggttgtgaagcaaagggaa
gaagatcatagttcccctgtttcagtccaagagtattggttaagtggagaaagttcacct
tcaacaaacagcttgttgggtaatgcatctcagcgagaatga

DBGET integrated database retrieval system