KEGG   Gossypium hirsutum (upland cotton): 107898935Help
Entry
107898935         CDS       T04793                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107898935
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     107898935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 DAO EF-hand_6 EF-hand_5 EF-hand_7 Pyr_redox_3 NAD_binding_8 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 107898935
NCBI-ProteinID: XP_016679993
UniProt: A0A1U8IUA3
Position
17
AA seq 582 aa AA seqDB search
MTILSFFTRASRAFNGYPSSSKLLLLCTLSLSGGGVVAYSEAQVDASKTSVQVNEKDCKK
KRVVVLGTGWAGISFLKDLDVSAYDVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRN
IIKKRNGEIQFWEAECMKIDAANKKLLCRYTVENNLVGNDEFSLEYDYLVIAVGAQVNTF
NTPGVLENCHFLKEVEDAQKIRRTVIDCFEKAVLPGLSEEERRINLHFVIVGGGPTGVEF
AAELHDFVQEDLVNLYPSVKDMVKITVIQSGDHILNMFDERISSFAEQKFQRDGIEVQTG
SRVISVSDKEITMKLKAKGEICSVPHGLVVWSTGVETRPFVKDFMGQIGQANRRVLATDE
WLRVKGCEDVYALGDCATINQRKVMEDIAAIFKAADKDNSGFLTVEEFKDVIDDILERYP
QVEHYLKSKHLRDVTDLMKDSEGNYIDKVDIEGFKLALCQADSQVKNLPATAQVAAQQGA
YLSKCFNRKSKWKDNPEGPRRFRGSGRHQFHPFQYKHLGQFAPLGGEQAAAELPGDWVSM
GRSTQWLWYSVYASKQVSWRTRVLVVSDWTRRFIFGRDSSRI
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcctgtctttcttcaccagagcttcacgggctttcaatggctacccttcttct
tccaagcttttgcttctctgtactctcagtctcagtggtggaggtgttgtggcttactca
gaagcacaagtagatgctagcaaaactagtgttcaagtgaacgaaaaagattgcaagaaa
aagagagtggtggttcttggaacgggatgggccggtattagtttccttaaagatcttgat
gtttcggcttatgatgttcaggttgtttcaccccggaattattttgcattcaccccattg
ttgcctagtgtcacctgtggaacggttgaagcacggagcattgtagagcctgttcgaaac
attataaagaagagaaatggagaaatacagttttgggaagctgaatgtatgaagattgat
gctgcaaacaagaaacttttgtgccggtatactgtggaaaataacttggtgggaaatgat
gaattctctttggaatatgactatttggttatagcagtgggagcacaagtaaatacattt
aacacccctggtgtccttgagaactgccactttctgaaggaagtcgaggatgcacagaag
atacggaggaccgttattgactgctttgaaaaggctgtccttcctggactaagtgaagaa
gaacgaaggataaaccttcattttgtaattgttggagggggacctactggtgtggagttt
gcagcagagttgcatgactttgttcaggaggatttggtcaacttatatccttcggttaaa
gatatggtgaaaataactgtgattcaatcaggggaccatattctgaatatgtttgatgaa
cgaataagtagtttcgctgagcaaaaatttcaaagagatggtatcgaagttcaaactgga
tctcgtgttattagtgtttccgataaggaaatcactatgaagctcaaggcgaaaggagag
atttgttctgtacctcatggattggttgtttggtccactggtgttgagactcgccctttt
gtgaaggacttcatggggcaaattgggcaggctaatagacgtgttctagcaaccgatgaa
tggttgcgagtaaaaggatgtgaagatgtgtatgcccttggtgattgcgccactataaat
cagcgtaaagtcatggaagatatcgctgccatatttaaggctgcagataaagataactct
ggtttcttaaccgttgaagaatttaaagatgttatagacgatatccttgagaggtatcca
caagtggaacactatttgaagagcaagcacctgagggatgtaactgatctgatgaaagat
tccgaggggaattatatagataaagtggacattgaaggatttaagctagccctttgtcaa
gctgattcacaagtgaagaatctgcctgcaacagctcaggttgcggcacaacaaggtgca
tatctttctaaatgcttcaaccgcaagtctaagtggaaagataatcctgaaggcccacgg
cgttttagagggtctggtcgtcatcaattccatccatttcaatacaaacaccttgggcaa
tttgctcctttaggaggggagcaagcagctgctgagctgcctggggactgggtttccatg
ggtcgtagcacacagtggctctggtactctgtatatgcaagcaaacaagtgagctggcgt
actcgggtgttggtggtatccgattggactcgaagattcattttcggaagagattcaagc
cgcatttga

DBGET integrated database retrieval system