KEGG   Gossypium hirsutum (upland cotton): 107902809Help
Entry
107902809         CDS       T04793                                 

Definition
(RefSeq) probable glycosyltransferase At5g11130
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ghi01003]
    107902809
Enzymes [BR:ghi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     107902809
Glycosyltransferases [BR:ghi01003]
 Polysaccharide
  Structural polysaccharide
   107902809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin
Motif
Other DBs
NCBI-GeneID: 107902809
NCBI-ProteinID: XP_016684415
UniProt: A0A1U8J262
Position
19
AA seq 459 aa AA seqDB search
MADPSCTIPFFVYPSIFLILFFTSINHHYRLFSFYSVISNHTKVSRENYSDISNSHTPIS
SAPDFHNDAQKKIQIEVLEEELAMAREAIRAAFRSRSYTSNRPESYVPKGSVYRNPFAFH
QSHIEMQKRFRVWTYKEGDSPLFHNGPVNDIYSIEGQFIDELESDISPFLARSPDEALAF
FLPVSVVNIIKYVYRPYTNYSRERLQHIVKDYIGIVSTRYPYWNRSNGADHFMISCHDWA
PDVSAKDPKLFKNFIRVLCNANSSEGFKPERDVSMPEVYIRFGALAQSQKNRPPNNRSIL
AFFAGGEHGDVRKILFKYWEKKDNDIRVFRYLPKTLNYTELISRSKFCLCPSGYEVASPR
VVESILSGCVPVIVSDHYVLPFSDVLDWSKFSVYVPIAKIPEIKTILQGISEEEYLEKQR
KVLKVQRHFVLNRPAKPYDIMHMVMHSVWLRRLNRRLSD
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggctgatccgagttgcaccatccctttcttcgtatacccttctatcttccttattctc
ttcttcacttccatcaatcaccactaccgtctcttctccttttattctgttatatccaat
cacactaaggtttcccgagaaaattattctgacatttcaaactctcatactccaattagt
tctgctcctgattttcataatgatgcgcaaaagaagatccagattgaggttttggaagaa
gagttggcgatggcaagagaggccatacgagcggcatttcggtctcggagttatacttcc
aacaggccggagagttacgttcccaagggatcagtttatagaaaccctttcgcgtttcat
cagagccacattgaaatgcagaagcgattcagagtgtggacatacaaggaaggagattca
ccgctatttcataatggtccagtaaatgatatatactcaattgaggggcaattcattgat
gagcttgagagcgatatttcaccatttttagctcgaagccccgatgaagcccttgcattt
ttcctccctgttagcgtcgtgaatattataaagtatgtttacaggccttatacgaattat
tctcgtgagcgccttcagcacatagtgaaggactacattggcatagtatcaaccagatat
ccctactggaacagaagcaatggagccgatcattttatgatctcttgtcatgattgggca
ccggatgtttcagctaaggacccgaagcttttcaagaatttcattagagttctttgcaat
gccaactcctctgaaggatttaaacctgaaagagatgtttcaatgccagaagtgtacatt
cgttttggggctcttgcacaatcccaaaagaaccgacccccaaacaaccgttcaatccta
gccttcttcgcaggcggcgaacacggggacgtgagaaaaatactattcaaatactgggag
aaaaaagacaatgatattcgagttttccgatatctccccaaaaccctaaactacactgag
ctaataagccgaagtaagttttgcctttgccctagtgggtacgaagtggcaagcccaaga
gtcgtagaatcgatactttccggttgtgttccggtgattgtttccgaccactacgtgctt
ccgttcagcgatgtccttgactggagtaaattttccgtttatgttcccatcgcaaagata
ccggaaatcaaaacaatactgcaagggatttctgaggaagaatatttggaaaaacaaagg
aaggtcctcaaggtgcaaagacattttgtgcttaatcgaccagccaaaccatatgatata
atgcatatggtgatgcattcagtatggcttaggaggcttaaccgaagattatcagattaa

DBGET integrated database retrieval system