KEGG   Gossypium hirsutum (upland cotton): 107905154Help
Entry
107905154         CDS       T04793                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP62-like
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ghi03110]
    107905154
Enzymes [BR:ghi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107905154
Chaperones and folding catalysts [BR:ghi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    107905154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_19 TPR_8 TPR_11 Fis1_TPR_C TPR_14 TPR_9
Motif
Other DBs
NCBI-GeneID: 107905154
NCBI-ProteinID: XP_016687219
UniProt: A0A1U8JG21
Position
19
AA seq 603 aa AA seqDB search
MEVEKGKGTDVSDVQGEDDLDEEPGEEIESAPPLKVGEERELGNSGIKKKLLNNGIHWET
PEFGDEVTVHFVGTLLNGIKFCSTRDNGEPMTFKLGEGKVAKGLDNGITTMKKGERVLFT
LPPDFGYGAEGRDGVPPDSIVQFDVELLSWITVVDICKDGGIIKKIMEKGERNERPSDLD
EVLVKYQVALADGTIVAKTPEEGYEFYVKDGHLFPALTKAIVTMKRGEKVKLIVQPKYAF
GDKGKEATDGFPSIPPNSVLNVELELISFKPVIDVTGDSKVFKKILKEGEGALVANEGAA
VTISYIAWLEDGTVFERKGVDGEQPLEFITDEEQVIPGLDRAAATMKKGEQALLTVSPEY
GFGSVVAERDLAVVPPSSNLVYEVGMLDFVKEKAPWELNNQEKIEAAGKKKEEGNILFKD
GNYQRAGKKYDKAVDYVSEDGLFQDDEQKQIKALGISCWLNGAACSLKLSDFWGAIQLCS
KVLDFESHNVKALYRRAQAYMKTSDLISAEMDIKKALEADPQNREVKLLQKTLRQLQIES
NKRDAKLFTNMFARMSKRSSMPIKKLKVEIAEPEKSEEAAATERECVAEPSTPSEDRMAV
DQS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagagaaagggaaaggaaccgacgtttcagacgtacagggcgaagatgacctc
gacgaggaacctggggaggaaattgaatcagctccgcctcttaaggttggtgaggagaga
gagttgggtaattccggtatcaagaaaaaactcctcaacaatggtatccattgggaaacg
cctgagtttggcgacgaagtcaccgttcatttcgtgggtactttgcttaacgggataaag
ttttgttccacaagggataatggtgaaccgatgacttttaagcttggtgaaggtaaagtg
gctaagggtttggataatgggattacaactatgaagaagggggaacgtgtattgttcaca
ttgcctccggatttcggttatggagctgaagggcgtgatggtgtcccacctgattcaatt
gtacaatttgatgttgaacttctttcgtggatcactgttgtggacatatgcaaagatggt
ggtatcattaagaagattatggagaagggagagaggaatgaacggcctagtgatttagat
gaagttcttgtcaagtatcaagtggcgcttgccgatgggactattgtagcaaaaacccct
gaagaaggatatgagttttacgtgaaagatggtcatctttttccagcattgacaaaagca
attgtaacaatgaaaaggggagagaaggtcaagctaattgttcaaccgaagtatgctttt
ggagataaggggaaggaggctactgatgggttcccaagtatcccaccaaattcagttttg
aacgttgaactggaattgatctctttcaagcctgttatcgatgttacaggagattctaag
gtattcaaaaaaattctgaaagagggagaaggtgctcttgtagcaaatgaaggtgctgca
gtaactattagctatattgcttggttagaagatggtactgtatttgagagaaaaggagtt
gatggagagcagccattggaatttataacagatgaagaacaagtgattccgggtttggac
cgagcagcagcaacgatgaagaagggggaacaagcattgttgacagttagtcctgagtat
ggttttggtagtgttgtagcggagcgtgatcttgctgtagtcccaccttcttcaaaccta
gtctatgaagttggaatgttggattttgttaaggaaaaagccccatgggaactgaataat
caagagaaaattgaggctgctgggaaaaagaaagaagaagggaatattctctttaaagat
gggaactatcaacgagcaggaaaaaagtatgataaggctgtggactatgtcagtgaagat
ggactctttcaggatgatgagcaaaagcaaataaaagcattggggatttcttgctggttg
aatggtgcagcatgtagcctcaaactaagtgatttctggggggcaatccagttatgttcc
aaggtactagatttcgagtcccacaatgtgaaagctctatataggcgggcacaagcctac
atgaaaacttcagatctaatatcagctgaaatggacatcaagaaagctcttgaggctgac
ccccaaaacagggaggtgaagctacttcagaagacactgagacaactccaaattgaaagc
aacaagagggatgctaaactctttacaaacatgtttgcacgaatgtcgaagagatcatct
atgcccattaagaaattgaaggttgagatagcagagcctgagaagagtgaagaggctgca
gcaactgaaagggaatgcgtggctgaaccttcaacaccttctgaagatagaatggcagtt
gatcagagttga

DBGET integrated database retrieval system