KEGG   Gossypium hirsutum (upland cotton): 107905357
Entry
107905357         CDS       T04793                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00100  Steroid biosynthesis
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Module
ghi_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107905357
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107905357
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 107905357
NCBI-ProteinID: XP_016687495
UniProt: A0A1U8JB04
Position
19
AA seq 369 aa
MDLGFLLQALIPSRNSVAVLLIFFAYLAIAGSILPGKLVPGVTLQDGSRLYYRCNGLRAL
LLLVGLLGIGSKMNFVSPTVISNRGLELLSTTFIFSFLTMVVLYAAGCRSCSKGSSLKPH
ITGNLIHDWWYGIQLNPQFMGIDLKFFFVRAGMMGWLIINLSVLAKSVQDGSLSQSMILY
QLFCAFYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLNNKVELT
TATAIANCFVFLIGYLVFRGANKQKHIFKQNPKAHIWGKPPKVVGGKLLASGYWGIARHS
NYLGDLLLALSFSLPCGLSSPIPYFYPIYLFILLVWRERRDEARCAEKYKDIWAEYCRLV
PWRIFPYLY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttcttctacaggctttaattccctctcggaactctgttgctgtattg
ttgatattctttgcttacttagctattgctggatctatattacctggaaaacttgttcct
ggagtcacattacaagacgggtctcgtctctattaccgctgcaatggattgcgagcactc
cttttgttagttgggctccttgggattgggtctaagatgaattttgtatcaccaactgta
atatccaacagaggacttgagctgttatcgacaactttcatattcagttttcttacaatg
gtagtactctatgctgctggctgcaggtcatgcagtaaaggttcttcattaaagcctcac
atcacagggaacctgatacatgactggtggtacggaatacagcttaatcctcagtttatg
ggtattgatctcaagttcttctttgttagagctggaatgatgggatggctaatcatcaat
ctatcagttcttgcaaaaagtgttcaagatggctctttaagccaatcaatgatcctttac
cagttattctgtgcgttctacatcctggactattttgtgcatgaggagtacatgacctcc
acttgggacataattgccgagaggttaggcttcatgttggtgtttggagatctagtgtgg
attcccttcacatttagcatccagggttggtggcttttgaataacaaagtggagctgaca
acagccactgcaatagcaaattgttttgtttttctgatcgggtatcttgtgtttagagga
gccaataagcaaaagcatatattcaaacagaacccaaaagcgcatatatggggtaaacct
ccaaaggttgtcggcggaaagctgcttgcttccggttattggggaattgcaaggcactca
aattacctcggggatttgttgctggctttatctttcagtttaccttgtggattaagttcc
ccaattccgtacttctacccgatttatctgtttattctattggtatggagggaaagacgc
gacgaagcacggtgtgcagagaagtacaaggatatatgggcagaatattgcaggcttgta
ccgtggagaatatttccatatctgtattag

DBGET integrated database retrieval system