KEGG   Gossypium hirsutum (upland cotton): 107907487Help
Entry
107907487         CDS       T04793                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ghi01009]
    107907487
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     107907487
Protein phosphatases and associated proteins [BR:ghi01009]
 HAD phosphatases
  Other HAD phosphatases
   107907487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 107907487
NCBI-ProteinID: XP_016690373
UniProt: A0A1U8MYR5
Position
19
AA seq 236 aa AA seqDB search
MGDVSGKRPTITHVIFDMDGLLLDTEKFYTEVQETILARFNKTFDWSLKAKMMGMKAIEA
ARVFVEETGISDSLSAEDFLVERESMLQSLFPTSELMPGASRLIEHLHAKGVPICLATGS
HRRHFELKTQRHGELFKLMHHIVLGDDPEVKKGKPAPDVFLAAARRFEGGPIDSEKILVF
EDAPAGARAAKNAGMSVVMVPDPRLDSSHHAIADQVLSSLMDFNPSEWGLPAFENA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgtttcaggcaaaagacccaccattactcacgtcatcttcgacatggatggt
ctcttactcgacacagagaagttctacactgaagtccaggaaaccattcttgctagattc
aataaaacttttgattggtctcttaaggcaaaaatgatgggaatgaaagcaatagaagca
gctcgagtctttgttgaggagactgggatcagtgattctctttcagctgaggatttcctt
gtagaaagggagtcgatgctgcagagtttgtttccaactagtgagctcatgccaggggct
agccgtttgattgaacatttgcatgcaaaaggagtaccgatttgcttggcaacaggaagc
cacaggcggcattttgagctaaaaacacaaagacatggtgagcttttcaaactcatgcac
catattgttcttggtgatgatccagaagttaaaaaagggaagccagcaccagatgtattc
ttagctgcagctagaaggtttgagggtgggccaatagattccgagaaaattcttgtgttt
gaagatgcacctgcgggagctcgtgcagctaaaaatgctgggatgtctgtggtaatggtt
ccagatccgaggctcgacagctcccaccacgccatagcagatcaagtcttgagttcctta
atggatttcaacccaagtgaatggggtttgcctgcatttgaaaatgcataa

DBGET integrated database retrieval system