KEGG   Gossypium hirsutum (upland cotton): 107909825Help
Entry
107909825         CDS       T04793                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107909825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ghi03041]
    107909825
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107909825
Spliceosome [BR:ghi03041]
 Complex C
  Other components
   Step II factors
    107909825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 ABC_tran Sigma54_activ_2 AAA_19 T2SSE AAA_33 DUF2075 Helicase_RecD AAA_16 AAA_14 AAA_23 AAA_29 ATPase_2 Sigma54_activat FtsK_SpoIIIE DAP3 RsgA_GTPase AAA_7 MMR_HSR1 Flavi_DEAD AAA_24 SRP54
Motif
Other DBs
NCBI-GeneID: 107909825
NCBI-ProteinID: XP_016692982
UniProt: A0A1U8JRS7
Position
20
AA seq 705 aa AA seqDB search
MANLPIVQFEKKIEETVDQNPVVVIIGETGSGKSTQLSQMLHRKGYTNSGIVAVTQPRRV
AAVSVSRRVAQELGVRLGEEVGYAIRFEDRTSERTRINYGVCRYLTDGVLLRESLSNPEL
NQYSVIILDEAHERSLNTDILLGLMKRLVKRRASNLKVLITSATLDGEKVSKFFSDCPLL
TVPGKLFPVEIFYSKERPTSYLESSLKTAMDIHVREPEGDILIFMTGQDDIEKLVSKLED
KVRSLEEGSCMDAIILPLHGSLPPEMQVRVFSPPPPNCRRFIVATNIAETSLTVDGVVYV
IDSGYVKQRQYNPATGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSRVYNDDFLD
VTVPEIQRSSLAGSVLYLKSLDLPDIDILKFDFLDPPSTESLEDALKQLYLIDAIDENGS
ITSIGRTMAELPLEPSLSRTLIEAKEYGCLSQALTVAAMLSAETNLLPGRSKNNEKKRKY
PPLELPDGSGFGDHIQLLQIYECWDENDYDIGWCKDYDLQVRGMMFVKEVRKQLSQIMQK
IAKGSSDVQVNQSQKRRQSYRNLRKALSIGFASQLAERMRHHNGFRTLGFKPQLVQVHPS
SVLKPDDDGLYPNYVVYHELIATSRPYMRNVCAVERQWVIPILEKLDKLDVRKLSGGGLG
HVEEITEGNTPDLLKKEAVIVTAPEEQESKIQAARERFLARKGKK
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcttccaatcgtgcaattcgagaagaagatagaagaaacagtggaccaaaat
ccagtggtggtgatcataggagagaccggttcgggaaagagcacgcagctctctcagatg
ctccaccgcaaaggatacacaaattccggaatcgttgccgtcactcagccccgtcgcgtc
gcagccgtatctgtttccaggcgagttgcgcaggagcttggtgttcggcttggggaagaa
gtaggctatgctattcggtttgaagatagaacttccgaaagaacacgaatcaactatggt
gtttgtagataccttactgatggagtgcttcttcgagaaagtctgtcaaatccggaactg
aatcagtattctgttattattctggacgaggctcatgagaggagtttgaatacggatatt
ttgctggggttgatgaaacgcttggttaaaagacgtgcatccaatttaaaagttctgatc
acatcggcaacccttgatggtgaaaaagtgtcgaagttcttttcagattgtcccttgttg
actgtccctggaaaattatttcctgtggaaatattctacagcaaggagcgacctacaagc
tatcttgagtcttcactaaaaacagctatggatatacatgttcgggaaccagaaggtgac
atcttaatattcatgactggacaggatgatatagagaagttggtatcaaagctggaagat
aaagttcgaagtctagaggaaggctcctgcatggatgctatcattcttcctctccatggt
tcattgccacctgaaatgcaggtgcgtgtattcagtcctccccctccaaactgtaggcgt
tttattgttgccacaaacatagctgaaacttctttgacagttgatggtgttgtgtatgtt
attgattctggttacgtgaagcaacggcaatataacccagcaactggaatgtattccctt
gatgttgttcaaattagcaaggtacaagctaatcaacgtgctggacgagctggaagaaca
cgtcctgggaagtgttaccgtttatacccatccagggtttacaatgatgatttccttgat
gtaacagttcctgaaatacagcgatcttctcttgctggcagtgttctttatctaaagtca
ttggacctccctgatattgatattctgaagtttgattttcttgaccccccttctaccgag
tcattagaagatgctctaaagcaactatatctgattgatgccattgatgaaaatggatcg
ataactagtattgggcgaacaatggccgagctcccattggaaccttcactttcgagaacc
ctaattgaggcaaaggaatatggttgcttatcccaggctctgactgttgcggccatgtta
tcagccgaaacaaatttgcttcctggtcgaagcaagaataatgagaagaaaagaaaatac
cctcctttggaacttcctgatggttctggttttggtgatcacatccagttgttacagatc
tatgaatgctgggatgaaaatgattacgatattggttggtgcaaagattatgacttacag
gtgcgaggaatgatgtttgtcaaagaagttcgaaagcagttatcgcagataatgcagaag
atagcaaaagggtcctcagatgtacaagtaaatcaaagtcagaaaagacgccagagttat
aggaatttgaggaaagcattgtccattggctttgcaagtcagcttgctgagcggatgagg
catcataatggctttcgaacactgggttttaagccccaactagtgcaggtgcatccttcc
tctgtgctaaagccagatgatgatggattatatccaaattatgttgtctaccacgaactt
attgctacctcacgcccatatatgcggaatgtgtgtgctgtagagcgtcaatgggtgata
ccaattttagagaaacttgacaaacttgatgtcaggaaattaagtggtggtggattgggt
catgtagaagagataactgagggaaacacgccagacttgctgaagaaggaagctgtcatc
gttacagctccagaagagcaggaaagtaaaattcaggcagcaagggaacgttttcttgct
cgcaagggaaagaaatga

DBGET integrated database retrieval system