KEGG   Gossypium hirsutum (upland cotton): 107909921Help
Entry
107909921         CDS       T04793                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 25 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107909921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Stress-antifung Pkinase_Tyr Pkinase DUF4448 APH ABC1
Motif
Other DBs
NCBI-GeneID: 107909921
NCBI-ProteinID: XP_016693118
UniProt: A0A1U8JWH8
Position
20
AA seq 502 aa AA seqDB search
MPSFNLISSVLLFFYIFDLAAEANPSFLYKFCYDKDTTFTTNSTYGTNLNLLLSSLTSNA
HRIDGFYNTTVGQQPPDRIYGLFLCRGDVTPDVCRDCVAAAARNATSLCPVEKNSVIWYD
KCMLRYSNESIFSTMETRPGGTVWDNDTFTEEEDFVDIVASLVKDVASEAADAPMGAKKF
ATKEANLSGSQKLYSLAQCTPDISDVACNLCLESAITEFSDCCRQKEKATRASSLLPSCN
VQYGLTPFYNKTAGEVSRSKPSPLPPRDSGKGKSSSQTIIYIIVPTVGFLVLLSTFCYCI
LRRKARMKPYLLKDQKDKSKARTMNSLQYDMSTIEAATDNFSDANMIGVGGFGSVYKGTL
ANGQQIAVKRLSRSSKQGAEEFKNEVALVAKLQHRNLVRLLGFCVEREERMLIYEFVPNK
SLDCFLFGLPLFNLKLSPKDTYMLWIKLLLMDIDTEKQKQLDWPTRLKIVKGTARGLLYL
HTDSRLKIVHRDLKPSNILCWS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttccttcaacctcatttcctctgtgcttttgtttttttacatctttgatctcgca
gccgaagccaacccaagtttcttatacaagttctgttatgacaaagataccactttcaca
acaaacagcacttatggaaccaatctcaatctcctcctctcttctcttacctccaacgcc
caccggatcgacggtttctacaacaccacggtggggcaacaaccacccgacagaatctac
ggtctcttcctttgtcgaggggatgttacaccggatgtttgccgagactgtgtggctgca
gctgccaggaatgctactagtctttgtcccgtggagaaaaactctgtgatttggtacgat
aaatgcatgctacgttactcgaatgaatctatcttttcgacgatggaaaccaggcctggt
gggactgtatgggataacgacacttttacggaagaggaagacttcgttgacatagtggcg
tctttggtgaaagatgtagcgagcgaggcagccgatgctccaatgggtgctaaaaagttt
gcgaccaaagaggcgaatcttagcgggtctcaaaagctgtacagccttgcacagtgcacg
ccggatatttccgacgtggcttgcaatttatgtcttgagagtgctattacagaattctca
gattgttgtcgtcaaaaagagaaagcaactcgagcaagttcattgctgcctagctgcaat
gttcaatatggattaaccccattttataacaaaactgcaggggaagtatccaggtccaag
ccatctcctctgccgccaagagattcagggaaagggaagagctcatcacagacaattatt
tacattattgttccaacggttggtttcttagtgcttttgtcaacattttgttattgcatt
ctaagaaggaaagcaaggatgaaaccctatttgctaaaggaccagaaggataaaagcaag
gctagaaccatgaattctttacaatatgacatgagcactattgaagcagctacagacaat
ttctctgacgcaaacatgattggtgtgggtggatttggcagtgtgtataagggtacactt
gcaaatggacaacaaattgcagtgaaaaggctatcaagaagttctaaacaaggtgcagag
gaattcaagaatgaggttgcgttggtagccaagcttcagcaccggaatcttgtgaggctg
ttgggattttgcgttgaaagagaagagaggatgctcatctatgagtttgtccccaacaaa
agcctagactgcttcctctttggtctgcccctcttcaacttaaagctttcaccaaaagat
acatatatgttatggattaaactgttacttatggacattgatactgagaagcagaaacaa
ttagattggccaacacgtctcaagatagttaaaggaaccgctcgtggacttctatatctt
catacagattcaaggctcaagattgtacatcgtgatctcaaaccaagcaatatcttgtgt
tggagctaa

DBGET integrated database retrieval system