KEGG   Gossypium hirsutum (upland cotton): 107912559Help
Entry
107912559         CDS       T04793                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: GPI transamidase component PIG-T homolog
  KO
K05292  GPI-anchor transamidase subunit T
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    107912559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 107912559
NCBI-ProteinID: XP_016696280
UniProt: A0A1U8K184
Position
21
AA seq 673 aa AA seqDB search
MVLLQRPHILLLLIGTHQFLQCWIAFGSVNEEGQKQEEFSEELLLKPLPDHKLLAHFHFQ
SSGPPSTSNGCHHHLFPKAISQLVQKFRIKEMELSFTKGRWNYESWGGFDPLSSSNAKPP
GVELWAVFDVPQHHIDASWKNLTHTLSGLFCASINFLESTATYSTPEWSFPPASGNVTYG
TLPCEAVCTENLTPWLKLLPCRDKAGIALLLDRPSLYRGFYHSQQLHLTSTGSSSEGIDS
GIILEQTLTVVLQPNSEMAIEVHASEKHIQPSWSLSSIFGKQVSGRCVLAKPSSVYLLLD
RGLVAELXFPNKENGKSAANGLTSENFWSNPSFELSANPDRIFLEESSSHSKSLSILYMF
QVEKYCESEPFDIGLMWKVPVAWLCQQTPLHASRFLMGSGNERAAIAISLKSTQFTEGFM
SANSKDGSCELRVDVFQVVPWYVKVYFHSLRVFVDQQPRAVSDIIEKIHVSPSKDKMSPG
VMEVVLKLPCRVNTAALTIEFDKGFLRIDEYLPDANQGFDIPSAIISFPNFHASMVFLED
DSLNKSPLLSKFQEKCPVMSYTEVLLVPLTTPDFSMPYNVITITCTVFALYFGSLLNVLQ
RRVAEEERFLKAKAAKKTGRLPLLLSKLSAKLRGRRLEPLHSPPSSSSFINSKLVLKVIL
VAGLAVGWQYFFS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggtccttcttcagagaccacatattttgctcctccttataggcactcatcaattcttg
caatgctggattgcttttggatcggtcaatgaagaaggccaaaaacaagaagaattcagt
gaagaacttctattgaagcctttgccggatcacaaactgttggctcatttccattttcaa
agctccggccctccttctacctctaatggctgccaccaccacttatttcccaaagccatt
tctcagttggttcagaaatttcgaatcaaggaaatggagttgtctttcacaaaaggtcgt
tggaactatgaaagctggggtggatttgatcccctatcaagcagcaatgcaaagccccct
ggagttgagttatgggctgtttttgatgtcccacaacatcatattgatgcttcctggaag
aacttaacacacactctctcaggtcttttctgtgcctcaatcaacttcttagagtctact
gctacttattctactccagaatggagttttccaccagcttcaggcaatgtgacgtatggt
acattgccctgcgaagctgtttgcacggagaatctgactccatggttgaagttgcttcct
tgtcgggacaaagctgggattgccttgttactggataggccatcactttacagaggtttt
tatcattctcagcagttgcatttaacctcaactggatctagttcagaggggattgattcg
ggcatcatattagaacagacccttacagttgttctccagcctaatagtgaaatggccatc
gaggtccatgctagtgaaaaacatattcaaccaagctggtctcttagttcaatttttggg
aaacaagttagtggaagatgtgttcttgcaaagcccagcagtgtgtatcttctccttgac
aggggcttagttgccgaactgtagtttccaaataaagaaaatgggaagtctgcagcaaat
ggtttgacctctgagaacttttggtctaatccgagctttgagctgtctgctaacccagac
aggatatttttagaagaaagcagttcgcatagcaagagcttatcaattttgtacatgttt
caagttgagaaatactgtgaatctgaaccatttgatattggtcttatgtggaaggttcct
gtagcttggttgtgtcaacaaacaccattacatgctagtaggtttttgatgggaagcgga
aatgagagggctgccattgctatttcattaaaatctacacaattcactgagggcttcatg
agtgctaattccaaggatggaagttgtgaactgcgagttgatgttttccaagttgtccct
tggtatgttaaggtctatttccattcattgagggtgtttgttgatcaacaacctagggct
gtttcagatattattgagaagatacacgtttcaccttccaaagataaaatgtctcctggt
gtgatggaggtggttctgaaacttccttgcagagtgaacactgctgctttaaccatagag
tttgataagggttttttgcgcattgatgaatatctcccagatgctaatcaaggatttgac
ataccatctgctattattagctttcccaacttccatgcaagcatggtttttctcgaagat
gactctttgaacaagtcacctctgttgtcaaagtttcaggaaaaatgtcctgtaatgtct
tacacagaagtcttacttgtacctttgacaactcctgattttagcatgccttacaatgtc
atcacaatcacatgcacggtgtttgcactatactttggatcattgctcaatgtgctgcaa
aggcgtgttgctgaggaggagagatttcttaaagccaaggctgccaagaaaactggccgg
ctacctctgctgctatcgaagttgtctgccaagcttagaggtagacgactggaacctctt
cattcacctccatcttcatcatctttcataaattctaaattagtattaaaagtcatacta
gtagctggacttgctgtaggttggcaatactttttctcttaa

DBGET integrated database retrieval system