KEGG   Gossypium hirsutum (upland cotton): 107912930Help
Entry
107912930         CDS       T04793                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00906  Carotenoid biosynthesis
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Module
ghi_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    107912930
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     107912930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 107912930
NCBI-ProteinID: XP_016696809
UniProt: A0A1U8K853
Position
21
AA seq 589 aa AA seqDB search
MASSSSQAVSTTNCKFLPVSTCFSSSLNLGSMPLKRTRRKPNISCSLQTPSILLLPNQSS
TDYTTKNAVKPQPQHWNPFQRAAAMALDVVENALVSHERHHPLPKTADPAVQISGNFAPV
PDRPVKHNLPVIGTIPDCLQGVYVRNGANPLHEPVAGHHFFDGDGMVHAVQFQNGSASYA
CRFTETNRLVQERALGRPVFPKAIGELHGHSGIARLLLFYARGLFGLVDPSHGTGVANAG
LVCFNGHLLAMSEDDLPYHVRVTPSGDLETVGRYDFDGQLKSTMIAHPKVDPETGEFFAL
SYDVIQKPYLKYFRFSPDGKKSPDVDIPVDGPTMIHDFAITENLVVIPDQQVVFKLPEMI
HGGSPVVHDKNKMSRFGILDKNATDASGITWVEAPDCFCFHLWNAWEEPETDEVVVIGSC
MTPPDSIFNECDESLKSVLSEIRLNLRTAKSTRRPIIPDSEQVNLEAGMVNRNLLGRKTR
YAYLALAEPWPKVSGFAKVDLSTGEIKKYIYGDQRYGGEPLLFPRNPNLENEDDGYILAF
VHDERTWKSEVQIVNAMNLEVEATVKLPSRVPYGFHGTFISSKDLEKQA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcttcatcacaggcagtatctactactaattgtaaatttcttccagtttca
acttgtttctcttcgtctctgaatttgggttctatgcctttgaaaaggactcgtagaaag
ccaaacatttcatgctctcttcaaacgccttccattcttcttttgcctaatcaatcatcc
actgattataccactaaaaacgcagtgaaacctcaaccccaacactggaatcctttccaa
agagctgcagctatggctttagatgtggtggagaacgctttggtttctcacgagcgtcac
catcctcttcccaaaacagctgaccccgctgttcaaatatctggcaactttgctccagtg
ccagaccgaccggtcaagcataacctccctgttattggaacaatcccagactgtttacaa
ggagtctacgttcgaaacggagccaacccacttcacgaacctgtcgccggacatcatttc
ttcgacggggacggtatggttcatgcggttcagttccaaaatggctctgctagttatgca
tgtaggttcaccgaaaccaaccgtctggttcaagaacgagctttggggcgtccagttttc
cccaaggccatcggtgaactccatggtcactctggtatagctaggctgttgcttttctat
gctcgtggcctatttgggcttgttgatccaagccatggcactggagttgctaacgctgga
cttgtttgttttaatggtcatctccttgctatgtccgaagatgatttgccttaccatgtt
cgtgttactccatctggggacttggaaactgttggtagatatgattttgatggtcagtta
aaatcaacaatgattgctcaccccaaggttgatcctgaaaccggtgaattctttgctctt
agctatgatgtcatccaaaagccatatcttaagtacttccgtttttcacccgatggtaag
aaatcacctgatgttgatatcccagtagacggtccgacaatgatccacgatttcgccatc
accgagaacttggtggtgattcctgaccagcaagtggtgttcaaattgcctgaaatgatt
cacggtggttccccagttgtacatgacaagaacaagatgtcaaggtttgggattttggac
aagaatgccactgatgcttctgggattacatgggttgaggcacctgattgcttttgtttc
catctttggaatgcttgggaagagccagaaactgatgaagttgttgtgattggctcctgc
atgacacccccagattccattttcaatgaatgtgatgagagtctcaagagtgtcttgtct
gaaatcagattgaatttgaggaccgccaagtcgacacgccgccccatcattccggattcc
gaacaagttaacttggaggcagggatggtgaaccgaaacttgctcggaagaaaaaccagg
tacgcatatttagcccttgctgagccttggcctaaagtgtcagggtttgccaaagttgat
ctctcgaccggagaaataaaaaagtatatctatggagaccaaaggtatgggggtgaacct
ttactcttccctagaaaccccaatttggagaacgaagacgacggttacattttggccttc
gttcatgacgagaggacctggaaatcagaagtgcagattgtgaacgccatgaatttagag
gtagaagccacagtaaagcttccatctcgagttccgtacggtttccatggaacattcata
agctccaaggacttggagaagcaagcctaa

DBGET integrated database retrieval system