KEGG   Gossypium hirsutum (upland cotton): 107914467Help
Entry
107914467         CDS       T04793                                 

Definition
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107914467
Enzymes [BR:ghi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     107914467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim ZinT
Motif
Other DBs
NCBI-GeneID: 107914467
NCBI-ProteinID: XP_016698878
UniProt: A0A1U8KD51
Position
22
AA seq 333 aa AA seqDB search
MASASENIYVEHVKGVNGLDKVILREIRGWSAEVYLYGGQVTSWKNERREELLFLSSKAL
FQPPKPVRGGIPICFPQFGNLDSLEQHGFARNRLWSVDPDPPPCSSHTNSRAFIDLILRH
SEEEAKIWSHRYELRLRVALGPAGDLMLTSRIRNTNTDGKSFTFTFAYHTYFFVTDISEV
RVEGLETLDYLDNLQNREQFTEQGGAITFESGEQGDAITFESEVDKIYLSTPTKIAILDH
ERKRTFELRKDGLPDAVVWNPWDKKAKAMADFGDEEYKHMLCVEAACVEKPITLKPGEEW
KGRQEISIVPSSYCSGQLDPRGQLDLRRVTFGC
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagcttcagagaatatttatgtcgagcatgttaaaggcgtcaatggtctcgat
aaggtcatcttaagggagattcgcggttggtctgctgaggtgtatctctatgggggtcaa
gtcacttcttggaagaatgaacgtcgggaggagttgctcttccttagtagtaaggcactt
tttcagccacctaagcctgttcgtggaggtataccaatctgtttccctcaattcggaaat
ctcgactctcttgagcaacatggatttgcaagaaatcgactttggagtgttgatcctgat
cccccgccatgttcatcacatactaatagcagggctttcatcgacttaattcttaggcat
tctgaagaagaggcgaagatctggtctcacaggtatgagcttcggttaagggtagctcta
ggacctgcaggtgatttgatgctgacttcccgcattcgaaatacaaacactgatggcaag
tcgtttacatttacatttgcctatcacacctattttttcgtcactgatatcagtgaagtg
cgagtagaaggactagagacactggattatttggataacctacagaatagagagcagttc
actgaacaagggggtgcaataacatttgaatcaggagaacaaggggatgcaataacattt
gaatcagaagtggataagatatatcttagtacaccaacaaaaattgccatcctggaccac
gaaaggaagcgaacatttgagttgcgaaaggatggacttccggatgctgtcgtgtggaat
ccctgggacaagaaagcgaaagcaatggctgatttcggtgatgaggagtataaacatatg
ctttgcgtagaggctgcttgtgtggagaagcccatcaccttgaaacctggtgaagaatgg
aaaggaagacaggagatctcaattgttccatcaagttactgcagcggacaactcgacccg
cgtggacaactcgacctgcgtagggtaacctttggttgttaa

DBGET integrated database retrieval system