KEGG   Gossypium hirsutum (upland cotton): 107914583Help
Entry
107914583         CDS       T04793                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog MMK1-like isoform X1
  KO
K14512  mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi04016  MAPK signaling pathway - plant
ghi04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107914583
   04075 Plant hormone signal transduction
    107914583
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107914583
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107914583
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107914583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 107914583
NCBI-ProteinID: XP_016699012
UniProt: A0A1U8KDI6
Position
22
AA seq 398 aa AA seqDB search
MEGGGRPQPPDTQMAEAAPPQQPVYQNALPLMFPRMQIPATPSYGGRVTQYNIFGNIFEV
TAKYKPPIMPIGEDAYGTVCSALNSETNESAAIKKIVNAFGNKVDAKRTLREIKLLRYMA
HENVVAIRDVIPPPQRECFNDVYIVYELMDTDLHQLICCNQKFNEEHYQYFIYQILRGLK
YIHTANVLHRDLKPSNLLVNENCDLKICDFGLGRVNTESDFMTEYVITRWYRPPELLLYS
SQYSAAIDMWSVGCIFMELFIRKPLFPGRDHLHQVRLLLELLGTPSEAEMEYVNENAKRY
IQQLPNYPGQSFSEKFPNVHPLAIDLAQKMLTFDPKQRITVEEALAHPYLTTLHDISDEP
VCMIRFTFDFEQHALTMAQMKELVYEEALAFNPDYSLQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaagggggagggcgacctcagccgccggacacccagatggcggaggcagctccgccg
cagcaacctgtctaccaaaatgcacttcctctaatgtttccccggatgcaaattcccgcc
actcctagctatggcggcagggttactcagtataacattttcggcaacattttcgaggtc
actgctaaatataaaccccctattatgcccatcggtgaagatgcttacggcaccgtttgt
tctgcgttgaattccgagacaaatgaaagcgccgcaataaagaagatagtgaatgcgttt
ggcaacaaggttgatgcaaagagaactcttcgtgagatcaagctgcttcgctacatggcc
catgagaacgttgttgcaatcagggatgtaattccacctccccagagagaatgctttaat
gatgtttatattgtatatgagctgatggacactgacctgcatcagctaatctgttgtaat
caaaagttcaatgaagagcattatcagtatttcatctatcaaatcttacgtggcctgaag
tatatacacactgcaaatgttctacatagggacttaaaacctagcaaccttcttgtgaat
gaaaactgtgacttgaaaatatgtgattttggactgggtcgtgtcaacactgaaagtgat
tttatgacagagtatgttattactagatggtaccgtcctccagaattgttgctatattct
tcgcaatattctgcagccattgatatgtggtcagtgggttgcatttttatggaactgttt
attcggaagccattatttccaggaagggatcatttgcatcaggtgcgattgctgttggag
ctgcttggcactccatcagaggctgaaatggaatatgtgaatgaaaatgctaagagatac
attcaacaacttcctaactaccccggacaatctttctctgagaagttcccaaatgtccat
cctttagctattgatcttgcgcaaaagatgttaacatttgatcctaaacaaaggattact
gttgaggaggcccttgctcacccctatctaacgacactgcatgacataagcgatgagcct
gtttgcatgatccgctttacctttgactttgagcagcatgctttaaccatggcgcagatg
aaggagttggtatatgaagaggcacttgcattcaacccagactattcattgcagtaa

DBGET integrated database retrieval system