KEGG   Gossypium hirsutum (upland cotton): 107914844Help
Entry
107914844         CDS       T04793                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00511  Other glycan degradation
ghi00600  Sphingolipid metabolism
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107914844
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107914844
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107914844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H
Motif
Other DBs
NCBI-GeneID: 107914844
NCBI-ProteinID: XP_016699377
UniProt: A0A1U8KA58
Position
22
AA seq 969 aa AA seqDB search
MVTGNLFHSKKNSWPPEEYVSRNTLQLFNFDSAAPPKQAWRRRLNSHANILKEFSVTFME
AIQMVRLGIRLWSYVREEASHGRKAPIDPFTRESCKPSASQGVPLGGMGSGSISRGFRGE
FRQWQIIPGTCNISPVMANQFSIFISRDGGNKKYASVLAPGQHEGLGKTSDEGISSWGWN
LNGQHSTYHALFPRAWTIYDGEPDPDLKVSCRQISPFVPHDYRDSSLPTAVFVYTLVNTG
KERAKVSLLFTWANSIGGISHLSGDHVNEPFIGEDGVSGVLLHHKTAKGNPPVTFAVAAS
ETQNVNVTVLPCFGLTEGSFITARKMWGKMMQDGQFDRENFNIGPSMPSSPGETLCAAVS
ASAWVEPHGKCTIAFALAWSSPKIKFSKGSSYHRRYTKFYGISERAAVDLVHDALTNYKH
WEEEIEKWQSPILEDIRLPEWYKFTLFNELYFLVAGGTVWIDSSSPSADVKSDQDPPIKV
ESKNIKVTEAEMNCRHSTGFEHTSTSGCNSSTGVGLKQNGSSTIPRKKRSCKHFSHHLKT
EDQLDGNEDVGRFLYLEGVEYIMWCTYDVHFYASFALLELFPKIELNIQRDFAKAVLSED
GRKVKFLAEGNYGIRKVRGAVPHDLGTHDPWNEMNAYNIHDTSKWKDLNSKFVLQVYRDF
AATGDMAFGIEVWPAVRTAMEYMEQFDRDDDGLIENDGFPDQTYDAWTVHGVSAYCGCLW
LAALQAAAAMAQRLGDKFFAETCKTKFFSAKSAFEKKLWNGSYFNYDSGSSSNSKSIQAD
QLAGQWYTSSSGLGPIFDEFKTRSSLQKIFDFNVMKVKGGRMGAVNGMHPNGKVDESCMQ
SREVWTGVTYAVAANMLLAGMEEEAFTTAEGIFIAGWSEEGFGYWFQTPEGWTTNGHYRS
LIYMRPLAIWSMQWVLSPPKAIIEAPKINMMDRIVISPATFSLSLPETRVRKIANKTACF
GNSSLQCTC
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggttactggaaacttatttcattctaaaaagaattcatggccgcctgaagaatatgtc
agccgtaatactttacaattgtttaattttgatagtgctgccccaccaaaacaagcttgg
agaagaaggttaaacagccatgctaatattcttaaagaattcagtgttacatttatggaa
gcaatacagatggtgcgattaggcatacgtctatggtcctatgtcagggaagaggcttct
catggaaggaaagcacccattgacccttttacccgagaaagttgtaagccatctgcatct
caaggagttccactgggagggatggggagtggcagtatatccaggggtttcagaggtgag
ttcaggcaatggcaaattatccctggaacttgcaacatttcacctgttatggctaatcaa
ttttctatatttatatctcgcgatggagggaataagaagtacgcatcagttttggctccc
ggacagcatgaaggactaggcaaaactagtgatgagggtatttcttcatggggatggaat
ctgaatggtcagcattctacataccatgctttgtttcctagagcatggacaatatatgat
ggtgaaccagatccagacctaaaagtgtcctgtcgacagatatcaccttttgtgccacat
gattatagggacagcagtcttccaacagctgtttttgtctacacgttggtgaatactgga
aaagaaagggcaaaagtcagcttactcttcacttgggcgaattcaattggtggaatttca
cacttatcaggagatcatgtcaatgaaccattcataggtgaagatggagtttctggcgta
cttcttcatcacaagactgctaaggggaaccctcctgtcacttttgcggttgctgcatct
gaaacacagaatgtcaatgtaacagttctaccctgttttggtctaactgaaggaagtttt
ataacagcaaggaagatgtggggaaaaatgatgcaggatggacaatttgatcgtgaaaat
ttcaatattggaccaagcatgccttcatcacctggagagacattgtgtgctgcagtttca
gcctctgcttgggtggaacctcatggaaagtgcaccattgcatttgctcttgcttggtct
tctccaaaaataaagttttcgaaagggagctcataccatcggagatacacaaaattctat
ggcatatctgaaagagcagctgtggacttggttcatgatgcactaacaaattacaagcat
tgggaagaagagattgagaaatggcaaagccctatcctcgaggatataaggctgccagaa
tggtataaattcactctgtttaatgagctctactttttggttgctggtggaactgtttgg
atagattcttcctcgccatctgcagatgtgaaaagtgatcaagatccaccaataaaagta
gaaagcaaaaatataaaagtaactgaagctgaaatgaattgtaggcatagtactgggttt
gaacatactagtacaagtggttgcaacagttcaaccggtgttgggttaaaacagaatggc
agttcaactattcccaggaaaaaacgaagctgcaagcacttctcgcatcacttgaaaacg
gaggatcaacttgatggcaatgaagatgttggtaggttcctgtacttggaaggagttgaa
tatatcatgtggtgcacttacgatgtacatttctatgcatcatttgcccttcttgagctt
tttcccaaaattgaactcaatattcaacgtgacttcgccaaagcagttttatctgaggat
ggaaggaaagtaaagtttctagcagagggtaattacggaattcgtaaggttagaggagct
gtccctcatgatctagggacacatgatccttggaatgaaatgaatgcatataatatacat
gatacaagcaaatggaaggatctgaattccaagtttgtgcttcaagtgtacagagatttt
gctgccacaggagatatggcatttggtattgaagtttggcctgctgtacgcactgcaatg
gaatacatggaacaatttgatagagacgatgatggcctcattgaaaatgatggatttcca
gatcaaacatacgatgcttggactgttcatggtgtgagtgcttactgtggttgcttatgg
cttgccgcgctccaagctgctgctgcaatggcccagcggctaggcgataagttctttgct
gaaacatgcaaaaccaaattttttagtgcaaaatcagcatttgagaagaaactatggaat
ggttcttatttcaactatgacagtgggtctagtagtaatagtaagtcgatacaagcagac
caactggcaggacaatggtacacatcatcttcaggcttgggtcccatctttgatgagttc
aaaacaagaagttctcttcagaaaatatttgatttcaatgtgatgaaagttaaaggaggc
aggatgggtgctgtaaacggaatgcatccgaatggaaaagtggatgagtcttgtatgcag
tcacgtgaagtatggaccggtgttacctatgctgttgcggcaaatatgcttcttgctgga
atggaggaagaagcattcactacagctgaaggtattttcattgcaggctggtcagaagag
ggtttcggatactggttccagacaccggaaggttggacaaccaatgggcattaccgatca
cttatatacatgaggcctcttgcaatatggagtatgcaatgggtattatctccacctaaa
gcaattattgaggcccctaaaataaatatgatggacagaattgtgatttcgccggcaaca
ttttcattgtctcttcccgaaacacgagttagaaaaatcgcaaataaaacagcgtgcttc
gggaattcttcattgcaatgtacatgctga

DBGET integrated database retrieval system