KEGG   Gossypium hirsutum (upland cotton): 107915339Help
Entry
107915339         CDS       T04793                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107915339
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ghi03041]
    107915339
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107915339
Spliceosome [BR:ghi03041]
 Complex C
  Other components
   Step II factors
    107915339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C OB_NTP_bind HA2 AAA_22 DEAD AAA_19 ABC_tran AAA_23 AAA_29 AAA_30 Helicase_RecD RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 107915339
NCBI-ProteinID: XP_016699991
UniProt: A0A1U8KBW5
Position
22
AA seq 1116 aa AA seqDB search
MKNFSSSSNHRHPPPPGGHEPYLQRQHQQSSYQNKFRCVPNFQAVNNQYYRRRFLPPAST
TEGSVNSNALHRPNFIIKLLHDFSSSPSKPNNLQTLISQLDPSPQNSHIYTTGKIAASLI
FQEWSKTLSSVLHLWRSHLDGSIHYTPKLISNVIVPSDLVELNQNLKTLFSSHITGLMEG
ELVRKWQKKINEKSDEIADLSGQMGKRKYSLGRFYELHDKKKTLKAERSTISKRLKEFKG
GMRSLLRCLETGEIGNEEGDEGVEVYRVEGELDWKLIHQLILRECRRLEDGLPIYARRQE
ILTRIHGQQIFSFDFLLQLFNAQVTVLIGETGSGKSTQLVQFLSDSGIAANESIVCTQPR
KIAAISLAKRVREESIGCYSDNSVICYPTFSSSQQFHSKVIYMTDHCLLQHYMKDKNLSG
ISCIIVDEAHERSLNTDLLLALVKDLLGRRFDLRLVIMSATANANQLSDYFFGCGIFHLE
GRNFPVDIKYVPCATEGTSGSGMVATYVSYVLRMAAEIHKTEKEGNILAFLTSQMEVEWA
CDHFEAPNAIVLPLHGKLSFEEQCHVFQNYPGKRKIIFATNIAETSLTIPGVKYVIDSGM
VKESKFEPGTGMNVLKVCWISQSSANQRAGRAGRTEPGRCYRLYTESDFELMTSNQEPEI
CRVHLGIAVLRILALGIKNIQTFDFVDAPSPKAIDSATRNLIQLGAIVEKNGVFELTDEG
RYLVKLGIEPRLGKLIISCFHCGLRREGLVLAAVMANASSIFCRVGNDDDKVKADCLKVQ
FCHQNGDLFTLLSVYKEWEALPSDRKNKWCWENSINAKSMRRCQDTVTELEICLKKELAV
IIPSYLIWDPHKSTKHDKTLKAVILSSLAENVAMYSGHDQLGYEVALTRQYVQLHPSCSL
LIFGQKPSWVVFGELLSITKQYLVCVTAFDYESLATLDPPPLFDASQMESRKLQVKALTG
FGSTLLKKFCGKSNHNLRSLSSRIKTVCKDERIGVEVNVDQNEILLFASSVDMQKVLDFV
TDVLECEKKWLHNECMEKPLFHGRSASPCMALFGAGAEIKHLEVDKRYLAVDVFHSNLNA
IDDKELLIFFEKHSNGGICSPEKLLSWMGLTSPALR
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacttctcttcatcctccaaccaccgtcatccgccgccgccgggtggtcatgaa
ccgtacctccagcgccagcaccaacaatctagctaccaaaacaagttccgttgtgtaccc
aattttcaggctgtcaacaatcaatactaccgccgccgttttctgccgccagcatccacc
accgaaggttccgtcaactccaacgcccttcaccgcccaaacttcataattaaactcctc
catgacttctcctcctctccttccaaaccgaacaacctccaaactcttatttcccaactc
gacccatccccccaaaactctcacatttacaccactggtaaaatcgccgcttccctaatt
ttccaagaatggagcaaaaccctctcttcagttctccatttatggcgttcccaccttgat
gggtccatccattacactcccaagcttatttccaacgtcatcgtgccttctgacctggtg
gagctcaatcaaaaccttaaaacccttttctcgagccatataacgggattgatggaaggg
gaactggttaggaagtggcagaaaaaaatcaatgaaaaatccgatgagatcgctgacttg
tctggacaaatgggtaagaggaaatattcgctgggaaggttttatgagttgcatgacaag
aagaaaactttaaaggcggaaaggtctacgatttcgaagcggttgaaggagtttaaggga
gggatgaggagcttgttgaggtgcttggaaactggggaaattgggaatgaggaaggggat
gaaggtgtggaggtttatagggttgaaggagagcttgattggaagctaatccatcagctg
attttgagggaatgtagaaggttggaagatggtttgcctatttatgctcgtaggcaagaa
attcttactagaatacatggtcaacagatattttcctttgattttctcttacaactattc
aatgcccaggtaacggtgttgattggagagactggttcaggaaagagcacccagctggtt
cagtttctttctgattcaggaatcgctgcaaatgagtcaattgtatgtactcagccacga
aagattgctgccatctctttagcaaaaagagttagagaagaaagcatcgggtgctacagt
gataactcagtcatttgttatccaacattttcatcctctcagcagtttcattcaaaggtg
atatatatgactgaccactgtttactgcagcattatatgaaggataagaatttgtccggc
atttcttgcatcatcgttgatgaggcccatgaaagaagtttgaacactgatcttcttttg
gcattggttaaagatttacttggccgaagatttgatttaaggcttgtaataatgtctgca
acagctaatgccaatcaactgtcagactacttttttgggtgtggaatctttcatttggag
ggtagaaactttcctgttgatattaagtatgttccttgtgcaactgagggaacttctggt
tctggtatggttgcgacatacgtttcttatgtcttgaggatggctgctgagattcacaaa
acagagaaagaagggaatattctcgcctttttgacttcccagatggaagtagaatgggct
tgcgatcattttgaagctccaaatgccattgttttaccattgcatggaaagctatccttt
gaagagcagtgtcatgttttccagaactaccctgggaagagaaaaattatttttgcaaca
aatattgcagagacttcacttacaattcctggggtcaagtatgtgattgattctggtatg
gtcaaggagagtaaatttgaacccggaactgggatgaatgttctaaaagtgtgctggatc
agccagagttctgctaatcaacgggctggtcgtgctgggaggaccgaaccaggaagatgc
tacagactatacacagaaagtgattttgagttgatgacttctaatcaggagcctgagatt
tgtagagttcatcttggtattgcagttttgaggatccttgctttaggaatcaagaatatt
cagacttttgattttgttgatgcgcctagtcctaaagccattgattcagcaactaggaat
cttatccagttgggagccattgtggaaaagaatggtgtttttgaattaactgatgaagga
cggtacttggtaaaattggggattgagcctcgtcttggtaaattgattatcagttgcttt
cattgtggcctgcgtagggaaggccttgttcttgctgctgttatggcaaatgccagtagc
atattttgcagggtgggaaatgatgatgataaagtcaaagctgattgtcttaaggtgcaa
ttttgccaccaaaatggtgatctctttactctgctctctgtgtacaaggaatgggaagct
ctcccttctgacaggaaaaataaatggtgctgggaaaacagcataaatgctaaatcaatg
cgcagatgccaagacaccgtaaccgaattagaaatttgtctaaaaaaggaacttgctgtt
attattccaagttacttaatatgggatcctcataagtctactaagcatgataaaacattg
aaggcggttatactttcctccctggctgaaaatgtagccatgtattccggacatgatcaa
cttggttatgaagtggcattgacccgacaatatgttcagctgcatccttcatgttcgttg
ctgatatttggtcagaagccaagttgggttgtttttggtgaactcttatccataactaag
cagtatttggtctgtgtaactgcttttgattatgaatctttggccactctggacccacca
cccttgtttgatgcctctcagatggaaagccggaagttgcaagtgaaggcattgactggt
tttggtagtactctattaaaaaaattctgtgggaaatccaatcataatcttcgatctctt
tcatcacggattaagactgtttgtaaggatgaacggattggagttgaagttaatgttgac
cagaatgagattttgctgtttgcctcatcagtggacatgcagaaggttctggattttgta
actgatgtgctggaatgtgaaaagaaatggttgcataatgaatgtatggagaaacctttg
tttcatgggcggagtgcctcaccatgtatggcactttttggagcaggagctgagattaag
catcttgaagttgataaaagatatttggctgttgacgtgttccattcaaatcttaatgcc
atcgatgataaggagctgttgatattctttgagaaacattcgaatggtggtatttgttct
ccagaaaagctgctgagctggatggggttgacttctccggctctgcgttga

DBGET integrated database retrieval system