KEGG   Gossypium hirsutum (upland cotton): 107915552Help
Entry
107915552         CDS       T04793                                 

Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ghi03021]
    107915552
Transcription machinery [BR:ghi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     107915552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 FliL
Motif
Other DBs
NCBI-GeneID: 107915552
NCBI-ProteinID: XP_016700184
UniProt: A0A1U8KHK1
Position
22
AA seq 338 aa AA seqDB search
MEEETNNIREIVQHDFPKTNKRKLQKPSDLEEMWGWLNSDDQGQKDEQICRKSDTDAEIE
AIFDKVKRRKKMEETSSRGIGLLVEKVMAQMEVAAEEDIELNIQNKPAIRKVQMLPLLTD
FLSKKKMQQEFLDHGILTLLKSWLDPLPDGSLPNATLRSSILNILTQVMPVDISLEDGRE
QLKKSGLGKVIMFLSKSDEETTANRKLAKHLVQNWCRTIFNKTTSYCNLRNSVIPRMKKP
LMKQSTRVELREADLDLEGPRRPCSSGTASGSVSVPEPAPCVYEVNPLTNFKPEFARRYR
RSREVRESECFERIEKKMSGLKKSNKKKTLQAPKSAVL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaaaccaacaacattcgtgagatcgtgcaacacgatttccctaaaaccaac
aagagaaagcttcaaaaaccgagtgatctggaggagatgtggggttggcttaactcagat
gatcaaggccaaaaagacgaacaaatctgtcgtaaatctgatactgatgcagagatcgag
gcgatcttcgataaggttaagagaaggaagaagatggaggaaacaagttcgcggggaatt
ggattacttgttgagaaagtaatggctcaaatggaggttgctgccgaagaagacattgag
cttaacatccaaaacaaacccgctattagaaaggtccaaatgctgcctcttcttactgac
ttcctctccaagaaaaagatgcaacaagagtttttggatcatgggattttaactttgttg
aagagttggctcgaccctcttcccgatggaagcttaccaaacgccacccttcgatcttcc
attttgaatatcttaactcaggtgatgcctgttgatatcagcttagaagatggaagggag
cagttgaagaagagtgggcttggtaaagtcattatgtttctttcaaaatcagacgaggaa
accactgccaatcgaaaacttgccaagcatttggtccaaaactggtgtcgaaccatattc
aacaagactacaagctactgtaacctcagaaacagcgtaattccaaggatgaagaagcca
ttaatgaagcaatcaacaagggtagaattgagggaggcagatttagatttggaaggtcct
cgcaggccatgttcatcaggaacagcaagcgggtctgtgtcagtgcctgaaccagcaccg
tgcgtttatgaggtgaaccctctaacaaatttcaaaccagagtttgcaagacgttatcgg
agatctagagaagtgagagaaagcgagtgttttgaaaggatagagaagaagatgagtgga
ttgaaaaaatcgaataagaagaagactctgcaagctccaaaatctgctgttttgtag

DBGET integrated database retrieval system