KEGG   Gossypium hirsutum (upland cotton): 107915745Help
Entry
107915745         CDS       T04793                                 

Definition
(RefSeq) glutamate--tRNA ligase, cytoplasmic-like
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00860  Porphyrin and chlorophyll metabolism
ghi00970  Aminoacyl-tRNA biosynthesis
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Module
ghi_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107915745
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107915745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ghi01007]
    107915745
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ghi03016]
    107915745
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ghi02048]
    107915745
Enzymes [BR:ghi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     107915745
Amino acid related enzymes [BR:ghi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   107915745
Transfer RNA biogenesis [BR:ghi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107915745
 Prokaryotic type
   Other AARSs
    107915745
Prokaryotic defense system [BR:ghi02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    107915745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C GST_C_3 GST_C GST_C_2 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 107915745
NCBI-ProteinID: XP_016700374
UniProt: A0A1U8KI66
Position
22
AA seq 728 aa AA seqDB search
MKEAGLKLLSFPPDSPPLSIISAAKIAGIDLPIQTSSSASSPTLSFSNGLKLHGNYVILR
YIGRLAPIPNFYGDNAFHAAQIDEWLEYTPTISCGSEFDNACGYMEVYLEKRTFFVSHYF
SIADIAIWSGLAGTGQRWESIRKSNKYPNLVRWYNSISAEYSNPLMEVIALYVGKKGLGK
PVAAKSKEVKNVTGDSSDKAKAGSRSSSEIDLPDAEMGKVRLRFAPEPSGFLHIGHAKAA
LLNQYFAQRYHGEVILRFDDTNPTKESNEFVENLIKDVETLGIKYQKITYTSDYFSKLMA
LAEKLIKEGKAYVDDTPREEMQKERMDGIESKCRSNSIEENLKLWKEMIAGSERGLQCCL
RGKLDMQDPNKSLRDPVYYRCNPVPHHRIGSKYKIYPTYDFACPFVDAEEGITHALRSSE
YHDRNAQYHRIQEDMGMRKVHIYEFSRLNMVYTLLSKRKLLWFVQNGKVDGWDDPRFPTV
QGIVRRGLKIEALIQFILEQGASKNLNLMEWDKLWTLNKKIIDPVCPRHTAVIEERRLLL
TLTNGPDKPFVRIIPRHKKYDGAGEKATTYTKRIWLDYADAECISVDEEVTLMDWGNAIV
KEIIKGQDGNITQLVGVLHLEGSVKTTKLKLTWLAETNELVNLSLVEFDYLITKKKLEEG
EDFLDALNPCTKKEIAAIGDSNMHNLKQGEILQLERKGYYRCDVPFTRSSKPVVLFAIPD
GRQQSVMK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagcagggttgaaactattatcatttccaccggatagccctccactttccatc
atctccgccgctaagattgcgggaattgatttacctattcagacttcatcctctgcgtct
tcacccactctgtctttctctaatgggctcaagttgcatggaaattatgtaattcttcgt
tatattggtcgtctggctcccattcctaatttctatggtgacaatgctttccatgctgcc
caaattgatgagtggctggagtacactcctaccatttcgtgtggttcagaatttgacaat
gcttgtggatacatggaggtatatttggagaaacgtacctttttcgtttctcattatttc
tccattgctgacatagctatatggtcagggcttgctggaactgggcagagatgggaaagc
ataaggaagtcgaacaagtacccaaaccttgttcgttggtacaattctatttctgcagaa
tacagcaatcccttgatggaagttatcgctttgtatgttggcaaaaaaggattgggaaaa
ccagtggcagctaaatcgaaagaggtaaagaatgtgaccggggatagttctgataaggct
aaagccggtagccggtcatcctccgaaatagatcttcctgatgctgagatgggaaaggtg
cgattgagatttgctcctgaaccaagcggttttcttcatatagggcacgctaaagcagct
ctgttaaatcaatactttgctcaaaggtaccacggtgaagtaatcttgcgctttgatgat
acaaatcccacaaaagaaagcaatgagtttgtagaaaatcttataaaagatgttgagaca
ttgggtatcaagtatcaaaagatcacctatacttcagattacttttcaaagttaatggct
ttggctgaaaagttgataaaagaggggaaagcctatgtggatgataccccacgtgaggaa
atgcagaaagaaaggatggatggcattgaatcaaaatgtaggagcaacagcattgaggaa
aatctgaagttgtggaaggaaatgattgctggctctgaaaggggattgcaatgctgcctt
cgtgggaagttagatatgcaagacccaaataaatctcttagggatcccgtgtactaccgc
tgcaatccggttccccaccatcgaattggatccaagtacaaaatatacccaacttatgat
tttgcttgtccgtttgttgatgctgaagaaggtataacacatgcactccgatctagtgag
tatcatgatcgcaatgctcaataccataggattcaagaggatatgggaatgcgaaaggta
catatatatgagtttagtcgattgaacatggtctatacacttctcagcaagcgtaaacta
ctctggtttgtgcaaaacggtaaagtagacggatgggatgatccccgtttcccaactgtc
caaggaattgttcgccgaggtctgaaaatagaggccttgattcaattcatcttggaacaa
ggggcatccaaaaatctcaatcttatggaatgggacaaactttggacccttaataagaag
atcattgatcctgtttgtcctaggcatacagcagtgattgaagaacgacgtttgttattg
accttaactaatggtcctgataagccatttgttcgcattatccctaggcataagaaatat
gatggtgctggagagaaggcaactacatacacaaagaggatatggttagactatgctgat
gcagagtgcatctcagtggatgaggaggtaaccttaatggattggggaaatgccatcgtg
aaagaaatcattaagggtcaggatggaaacataactcagttagtaggagttttgcatctt
gaaggatctgtcaagacaacaaagttaaagctcacgtggctagcagaaacaaatgaactg
gttaacctttccttggtggagtttgactatctaataacaaagaagaagctggaagaagga
gaggatttcctagatgcactaaacccatgtacgaaaaaggagatcgcagccatcggagat
tccaacatgcacaatttaaagcaaggagagatattgcagctggagaggaaaggctactac
agatgtgatgtgccctttactagatcttcaaagcctgtggttttgtttgcaattcctgat
ggcaggcagcaaagtgtgatgaagtaa

DBGET integrated database retrieval system