KEGG   Gossypium hirsutum (upland cotton): 107917392Help
Entry
107917392         CDS       T04793                                 

Definition
(RefSeq) xyloglucan 6-xylosyltransferase 2-like
  KO
K08238  xyloglucan 6-xylosyltransferase [EC:2.4.2.39]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ghi01003]
    107917392
Enzymes [BR:ghi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.39  xyloglucan 6-xylosyltransferase
     107917392
Glycosyltransferases [BR:ghi01003]
 Polysaccharide
  Structural polysaccharide
   107917392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_34 DUF273
Motif
Other DBs
NCBI-GeneID: 107917392
NCBI-ProteinID: XP_016702240
UniProt: A0A1U8KIF2
Position
3
AA seq 459 aa AA seqDB search
MIDNCLGAQRSRKIQRTLRHCKVTILCLVLTLVVLRGTIGAGKFGTPGQDFVEIRDHLYY
RKQGEPHRVLKEVQTTSSDNHDGADTNAGTNNYNEFDINKILIDEEPDVPKRDPNAPYSL
GPGISDWDEQRSRWLQENPNYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKI
DYCRLHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEV
PWERYKDSNFVMHGWNEMVYDQKNWIGLNTGSFLLRNGQWALDILDAWAPMGPKGKIREE
AGKVLTRELKNRPVFEADDQSAMVYLLATQREKWGDKVYLENSYYLHGYWGILVDRYEEM
IENYHPGLGDHRWPLVTHFVGCKPCGKFGDYSVERCLKQMDRAFNFGDNQILQIYGFTHK
SLASRRVKRVRNETSNPLEVKDELGLLHPAFKAVKVSAS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgatagacaattgcttgggagctcaaagatctagaaagatccagagaactctccgtcat
tgcaaggtcaccatcctctgcctcgtcctcaccctcgtcgtcctacgtggcactatcgga
gccggtaaattcgggactccaggccaggacttcgtcgagatccgggaccacctctattac
cggaaacaaggcgaaccgcatcgcgtcctcaaagaagtccaaacgacgtcgtcagataac
cacgacggcgccgacaccaacgccggcaccaataactacaacgagttcgacatcaataag
atcttaatcgacgaggaaccagacgtcccgaaacgcgatcccaacgcgccctattcgctc
gggcccggaatctccgattgggacgagcaacgctctagatggctgcaagaaaaccctaat
tacccaaatttcatcggtccaaacaaaccgagggttctcttagtcactggttcatctccc
aaaccttgtgagaaccctgtcggtgatcattacttattgaaatcgatcaagaacaagatc
gattattgtagattacacgggatcgagatattttacaacatggcgctgttggatgctgaa
atggcagggttttgggcgaaattgccgttgattcgaaagcttttgctctcgcatccggag
gtggaattcttgtggtggatggatagtgacgccatgtttactgacatggcatttgaggtt
ccttgggaaaggtataaagactccaactttgttatgcacggttggaatgaaatggtttac
gatcagaagaattggattgggctaaacactgggagttttttgttgaggaatgggcaatgg
gcacttgacattcttgatgcttgggctccaatgggtcctaaaggcaagattagggaagaa
gcagggaaggttttgacccgggagcttaagaatagacccgttttcgaagccgatgatcag
tctgcaatggtgtatttgttggctactcaaagggagaagtggggtgataaggtttactta
gagaattcttattatttgcacggttattgggggatcttggttgatagatatgaggaaatg
attgagaattatcacccaggtttaggggatcatcgttggccgttggtgacccactttgtg
gggtgcaaaccttgtggtaagtttggggattactcggtggagaggtgcttgaagcaaatg
gatagagcattcaattttggggataatcagattcttcagatttatgggttcactcacaag
tcattggccagtagaagggttaagagagtacgaaacgagaccagtaatccgctcgaggtg
aaagatgagcttggattgcttcatccggcttttaaagccgttaaggtatccgcttcttga

DBGET integrated database retrieval system