KEGG   Gossypium hirsutum (upland cotton): 107919475Help
Entry
107919475         CDS       T04793                                 

Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107919475
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     107919475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 107919475
NCBI-ProteinID: XP_016704416
UniProt: A0A1U8KPL3
Position
24
AA seq 208 aa AA seqDB search
MGLEAAVEAAAEFLNKDKTIIVQPDRVSRMGWHLVVLMKDFLTELVTRLKHNNTAYENYH
RIFVPVGHPLKTVEPKQPLRVDVLLQYIQNMLSSETTILAEAGDSWYEFHMQHGSIGWSV
GATLGDAQAVPEKREIACISDGNFQVTAQDVPAMLRCGQKSIIFLINNGGYTIEVEIHDR
PYHVIKNWNYTGLVEAIHNKGLLRGRAN
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgggattagaagcggcggtggaggcagcggctgagttcttgaacaaagacaagaccatt
atcgtgcagccggatcgggtatcgagaatgggttggcatttggttgtcttgatgaaagat
ttccttacagagcttgttactaggctcaaacacaataacactgcctatgagaattaccat
aggatatttgttcctgtaggacatcctttgaagacagtagaacctaaacaacctttgagg
gttgatgtcctgcttcaatacatacagaacatgctctctagtgaaactaccatcttggcc
gaagccggggattcttggtatgaattccatatgcagcatggatcgatcgggtggtcagtt
ggcgctactcttggggacgcacaggctgttccagagaaacgtgagattgcttgtatcagt
gatggtaatttccaggtgactgcacaagatgtgccggcgatgctacgatgtggacagaag
agtataatctttctgataaacaacggtggttacaccattgaagtcgagattcatgacagg
ccataccacgtgatcaagaattggaactacactggcttggtggaagcaattcataataag
ggtctgttgcgaggaagagctaattaa

DBGET integrated database retrieval system