KEGG   Gossypium hirsutum (upland cotton): 107920296Help
Entry
107920296         CDS       T04793                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like isoform X1
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00020  Citrate cycle (TCA cycle)
ghi00310  Lysine degradation
ghi00380  Tryptophan metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107920296
  09105 Amino acid metabolism
   00310 Lysine degradation
    107920296
   00380 Tryptophan metabolism
    107920296
Enzymes [BR:ghi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     107920296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N GCV_H
Motif
Other DBs
NCBI-GeneID: 107920296
NCBI-ProteinID: XP_016705415
UniProt: A0A1U8KSH9
Position
24
AA seq 471 aa AA seqDB search
MLGALRRKVAIGGSSASVLGKAIRPGISASRVSVNVGEEILLLQPRGIAHVRNFSHLILP
GCSVGLAKTRDVFSSIQLETIMQKSCRAFSSGGGDLVDVVVPFMGESISDGTLATFLKKP
GDSVAADEPIAQIETDKVTIDVVSPQAGVIQEYVAKEGDTVEAGAKIAVISKSGVGVAPA
ATAEKKSEKAASKPSPPAESVKEDKPKAKVEASPAAEKPKPPSSPPPKQTATEPVLPPKE
RERRVPMTRLRKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSDYKDAFVEKHGVKLGF
MSGFVKAAVSALQHQPIVNAVIDGDDIIYRDYVDISIAVGTPKGLVVPVVRDADKMNFAE
IEKTINNLAKKANDGTISIDEMAGGSFTISNGGVYGSLLSTPIINPPQSAILGMHSIVSR
PMVVGGNVVPRPMMYIALTYDHRLIDGREAVFFLRRIKDVVEDPRRLLLDV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcgctttaaggagaaaagttgcgattggaggctcgtcagcctcggtattaggg
aaagcgattcggccaggtatttcagcatctagagtttctgtcaatgttggagaagagatt
ctattacttcagcctagaggaattgcccatgtccgtaacttttctcatctcattctccca
ggttgttctgttggtttagcaaagacaagggatgtcttttctagcattcagttagagact
atcatgcaaaagtcatgcagggctttctcttctggagggggggatctggtcgatgttgtt
gtcccttttatgggagaatcaattagtgatggcactttagcaacattcttgaaaaaacct
ggtgattcagtagcagctgatgaaccaattgctcaaatagaaacagataaggtaacaatt
gatgttgtcagtccccaagctggtgtgatacaagagtatgtagcaaaggaaggagatact
gtggaagcaggtgccaagattgctgtcatttctaagtctggtgtaggagtagcacctgct
gctactgctgaaaagaaatcagaaaaagctgcttccaagccatctcctccagctgaatct
gtgaaggaagataagccaaaagctaaagttgaagcttctcctgctgcagagaagcctaaa
cccccttcttctccacctcccaagcaaactgctactgaacctgtacttccaccgaaggaa
agggaaagaagagttccaatgacaaggcttaggaaacgggttgctacacgattgaaagat
tcccagaatacttttgcaatgttaacaacgttcaatgaagttgacatgactaacttgatg
aagctccgatctgattacaaggatgcttttgttgagaaacatggtgtcaagttgggattt
atgtcgggatttgttaaagctgctgttagtgcacttcaacatcagcctattgtaaatgct
gtaattgatggggatgatattatttatagagattatgtagatatcagcattgctgttggt
actccaaaggggcttgtcgttccggtagttcgtgatgctgacaagatgaattttgctgag
atagagaaaacaatcaacaaccttgctaagaaagcaaatgatgggaccatttcaattgat
gaaatggctggaggctcatttacgatatccaatggtggtgtctatggcagtcttttgagt
acccccatcatcaaccctcctcagtcggcgatcttgggtatgcactcaatcgtgtcccga
ccaatggttgttggaggtaatgtagtgccgagaccaatgatgtacattgcactcacttat
gaccataggctgattgatggaagagaagcagtattctttttacgacgtatcaaggatgtt
gtcgaagaccctcggaggctgctactcgatgtctaa

DBGET integrated database retrieval system