KEGG   Gossypium hirsutum (upland cotton): 107924286Help
Entry
107924286         CDS       T04793                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00071  Fatty acid degradation
ghi00410  beta-Alanine metabolism
ghi00592  alpha-Linolenic acid metabolism
ghi00640  Propanoate metabolism
ghi01040  Biosynthesis of unsaturated fatty acids
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
ghi01212  Fatty acid metabolism
ghi04146  Peroxisome
Module
ghi_M00087  beta-Oxidation
ghi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107924286
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107924286
   00592 alpha-Linolenic acid metabolism
    107924286
   01040 Biosynthesis of unsaturated fatty acids
    107924286
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107924286
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107924286
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     107924286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 107924286
NCBI-ProteinID: XP_016710137
UniProt: A0A1U8L6A5
Position
26
AA seq 644 aa AA seqDB search
MKIVWAGSRQAYEISDRVARLVASDPVFRKDNRTMLSRKDLFKDTLRKAAHAWKRIIELR
LSEEEASKLRFFVDQPVFTDLHWGMFIPAIKGQGNEEQQQKWLPMAYKMQIIGCYAQTEL
GHGSNVQGLETTATFDPETDEFVIHSPTLTSSKWWPGGLGKVSTHALVYARLITDGQDHG
VHGFIVQLRSLDDHLPLPGITVGDIGMKFGSGAYNSMDNGVLRFDHVRIPRDQMLMGVSQ
VTREGKFMQSDVPRQLVYGTMVYVRQKIVADASCALSRAVCIATRYSAVRRQFGSHNGGP
ETQVIDYKTQQSRLFPLLASAYAFRFVGEWLKWLYTDVTRRLEANDFSTLPEVHACTAGL
KSVTTSATADAIEECRKLCGGHGYLSSSGLPELFAVYVPACTYEGDNVVLLLQVSRFLMK
TVSQLGSGKKPVGTIAYMGRSEHLLQCRCEVERAEDWLKPNVILEAFEARAARMSVTCAK
NLNNFPNQEEGFAQLATDLAEAAVAHVQLIIVSKFIEKLHQDIPGKGVKRQLEILFNVYA
LSLLHKHLGDFVTSGCITPKQGALANEQLRLLYSQVRPNAIALVDAFNYTDHYLGSVLGR
YDGNVYPKLYEEAWKDPLNETVVPDGYHDYIRPILKQHIRVARL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgtttgggctggttctcgccaagcttatgagatctccgatcgagttgctcgt
ctcgttgctagcgatccggtctttcgaaaggataatagaactatgctatctaggaaggac
ttgtttaaagatactttgcgaaaagctgctcatgcatggaagcggataattgagcttcgt
ctctctgaagaagaggcctctaaattaaggttttttgtcgatcagcctgttttcacagat
cttcactggggaatgttcatacctgcaattaaaggacaaggaaatgaggagcagcaacag
aagtggcttccaatggcatataagatgcaaattattggatgctatgcacaaactgagctt
ggtcatggctccaatgtccaagggctagagacgactgcaacatttgatcctgagactgat
gaattcgtcattcatagtcccacattgacttcaagcaaatggtggcctggtggactgggt
aaagtatccacacatgctttggtttatgctcgtcttattacagatggacaagaccatgga
gtgcatggttttattgtccagctgcgtagcttggacgatcacttacctcttcctggcata
acagtgggagatattggaatgaaatttggaagtggggcatataacagcatggataatggt
gttctgagatttgatcatgttcgcattccaagggaccaaatgctaatgggtgtttcacag
gttacaagagaagggaaatttatgcaatctgatgttcctcgccagctggtttatggtacg
atggtatatgtccgacaaaaaattgtagccgatgcttcttgtgctttatcaagggcagta
tgtattgcaacaaggtatagtgctgttcgtagacaatttggttcgcataatggtggcccg
gagacccaggtgattgactataaaactcagcaaagtagactcttccctttgcttgcttct
gcctatgctttcagatttgttggtgagtggctgaaatggctatacactgacgtgactcga
agattggaagccaatgatttctccacattacctgaggtccatgcatgtactgcagggtta
aaatctgttactacttctgcaactgcagatgcaatcgaagaatgccggaaattatgtggt
ggtcatggttatctttctagcagtgggctccctgagttatttgcagtttatgtccctgcc
tgtacttatgaaggcgacaatgttgtgctacttttacaggtttcaaggtttctaatgaag
accgtttcccagctggggtctgggaagaagcctgtcgggacaatagcttacatgggacga
tcagaacacctcttgcaatgccgttgtgaagttgaaagggctgaggattggctaaagcct
aatgtaatattggaggcatttgaagcgagggctgctaggatgtcggtcacctgtgcaaaa
aaccttaacaattttccaaatcaagaagagggttttgctcaactcgcaactgatttggct
gaggctgcagtcgctcatgttcagttaattattgtttccaagttcattgagaaattgcac
caagacatacccggaaagggagtaaaaagacagttggagatcctatttaatgtatatgct
ttaagtctgttacacaaacatcttggtgactttgtcacctccggctgcattaccccaaag
caaggtgcactagcaaatgaacagctgagattattgtactcccaggtccgtccaaatgct
attgcacttgttgatgcattcaactacactgaccattaccttggctccgttcttggtcgc
tatgatggaaatgtgtatccaaaactctatgaggaagcatggaaagatcctctgaacgag
actgtcgtacccgatggttaccatgattatattcggccaatattgaagcaacatattcgc
gttgcaagactctaa

DBGET integrated database retrieval system