KEGG   Gossypium hirsutum (upland cotton): 107924960Help
Entry
107924960         CDS       T04793                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ghi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107924960
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107924960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ghi01003]
    107924960
Enzymes [BR:ghi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     107924960
Glycosyltransferases [BR:ghi01003]
 Glycan extension
  P blood group
   107924960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 107924960
NCBI-ProteinID: XP_016711028
UniProt: A0A1U8LCC9
Position
Unknown
AA seq 433 aa AA seqDB search
MFQMSKLYHNFHHTKNSVFSFVFLLPLFLLLLLACNGFSVFYINLSVPAKTSPEPANLLL
EILPGDKPVKKLSSSSVMYAVKEENPSLNLKTHLSLLQNPNISMVLKPKKQPHRFSPQTL
KALQLRTTKTAKGFTFSTKLRAFFQNSNCKLRFVMTWISSLHSLSHRELLVIESVFKSNP
KACLVIVSTSLDSPKGNAVLKPFLNMGFNLITVSPDFGSIFKHTYAETWFNRLKTGNINP
GEVSLGQNLSNLLRLVLLYKYGGVYIDTDVIVLKSFNNLSNVIGAQSMKIETKTWSRLNN
AVLIFDKHHPLLYKFIQEFALTFDGNKWGHNGPYLVSRVVGRVTNGPEFNFTVLPPPAFY
PVDWSRIRSLFRGPNNWIQSDWLRRKLEQIRRQSYTVHLWNRQSKDVRVEEGSIVHHIIS
DCCIFCNISTSSL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaatgtctaaactttaccataatttccatcataccaaaaattcagtctttagc
tttgtgtttttattaccacttttccttcttcttcttttagcttgtaatggcttctctgtt
ttctacattaacctctctgttcccgccaaaacttcaccggagcccgccaatttgttactg
gagatccttcccggtgacaaaccggtgaaaaaattatcatcttcctcagttatgtatgca
gtgaaagaagagaacccatctttaaatttaaaaacccatttatctcttttacaaaacccc
aacatttcaatggttttaaagccaaaaaaacaacctcatcgttttagtcctcaaacattg
aaggctttgcaattaaggacaacaaaaacagcaaagggtttcactttctccaccaaatta
agggcttttttccaaaattcaaactgtaagcttcgttttgtcatgacatggatttcatca
ttacattcattaagtcatagagaattacttgtcattgaaagtgtgttcaaatcaaacccc
aaagcttgtcttgtcattgtatccacttcattagattccccaaaaggaaatgctgtttta
aaaccatttttaaacatggggtttaatttaatcactgtaagtcctgattttggttctata
ttcaagcacacatatgcagaaacatggtttaatcgattaaagacaggcaatatcaatcca
ggtgaggtttctttaggacaaaacctgtctaatctactccgattggtcttgttatacaaa
tacggcggcgtttatatcgacacagatgttattgttttaaaaagtttcaacaatttgagc
aatgtgattggtgcacagtccatgaaaattgagaccaaaacttggagtagattaaacaat
gctgtgttgatttttgataaacatcatccattgttgtacaaattcatacaagaatttgca
cttacttttgatggtaataaatggggtcacaatggtccttatttagtttcaagggtagtt
ggtagagttaccaatgggcctgaatttaacttcaccgtgttgccaccgccggctttttat
ccggtcgattggagtcggatccgtagcttattccgagggcctaataattggattcaatcg
gattggttacgtcgtaaactcgagcaaatccgaagacaaagctatactgttcatctttgg
aacaggcaaagtaaggatgttagagttgaagaaggtagcattgttcatcatattatatca
gattgttgtattttttgcaatatttcaacatcaagtttgtaa

DBGET integrated database retrieval system