KEGG   Gossypium hirsutum (upland cotton): 107925053Help
Entry
107925053         CDS       T04793                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107925053
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ghi03041]
    107925053
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107925053
Spliceosome [BR:ghi03041]
 Complex C
  Other components
   Step II factors
    107925053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA AAA_30 T2SSE AAA_14 Flavi_DEAD DUF2075 PhoH ABC_tran AAA_16 AAA_33 ATPase AAA_24 SRP54
Motif
Other DBs
NCBI-GeneID: 107925053
NCBI-ProteinID: XP_016711108
UniProt: A0A1U8LCK4
Position
Unknown
AA seq 649 aa AA seqDB search
LKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPLRVAAMSVAKR
VAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVIMLDEAHE
RTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYT
KQPESDYLDAALITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELII
LPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVVDPGFAKQNVYNPKQ
GLDSLIITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTTIPEIQRINLGMIT
LQMKAMGINDLLSFDFMDPPPPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPL
SKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTVLAVY
EAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVVCAGKNFTKIRKAITA
GFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVVD
PKWLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
ctgaaaaaagaactcattcaagctgtgcatgacaatcaggtactggtggtcattggtgag
actggttcaggtaagactacacaggtaacccagtaccttgctgaggctgggtacactaca
aggggtaagatcggatgtactcaacctcttagggtggctgcaatgtctgtggctaagagg
gtagctgaggaatttggttgtcggttaggggaggaagttggttatgctattcgctttgaa
gattgtactggaccagatactgtcatcaagtacatgactgacggcatgcttctaagggag
attctgattgatgagaatctttctcaatactcggtcattatgcttgatgaagcacatgag
cgtacaattcatactgatgtcctttttgggttattgaagcagcttgtgaaacggaggcct
gatcttcgtctgattgttacatctgctacactggatgcggagaagttttcagggtatttc
ttcaactgtaatattttcacaattcctgggaggacgtttcctgtggagatactctatacg
aaacagcctgagagtgactacctagatgctgccttgataacagtcctacagatacacttg
actgaacctgaaggtgacattctcctcttcttgactggtcaggaggaaattgattttgca
tgccagtctctttacgagaggatgaaagggctaggtaaaaatgttccagagttgattatt
ttaccagtttatagtgcccttcctagtgaaatgcagtctaggattttcgatccagcacct
ccagggaaaaggaaggtggtggtggcaaccaatattgctgaggcttctttaactatagat
ggaatattctatgtggttgatcctggttttgcaaaacaaaatgtttataatccaaagcaa
gggcttgattccctaatcataacaccaatctcacaagcatcagcaaagcaacgtgctggg
cgtgctggacgtactggacctggaaaatgctaccgcttatacactgaaagtgcatatcga
aatgagatgtcacctaccacaattcctgaaatccagaggattaatcttggcatgataaca
ctacaaatgaaggccatgggcataaatgatctcctttcttttgattttatggatccccct
ccaccccaagctctcatttctgccatggagcaattatacagtctaggggctcttgatgag
gagggacttttgactaaattgggtagaaaaatggcagaatttcctcttgatcctccacta
tccaagatgttactggccagcgtggacctcgggtgtagtgatgagatattgacaattatt
gcaatgatccaaacaggtaatatcttctacaggccaagggaaaagcaagctcaggctgat
cagaagagggccaagtttttccagcctgaaggagatcatttgactgtacttgctgtatat
gaagcttggaaagcaaagaacttttcaggaccttggtgttttgaaaattttgttcagtct
agatccttgaggagggcacaggatgtcagaaaacagcttctcagcatcatggataagtac
aaattggatgtagtgtgcgccggaaagaactttacaaagatcaggaaagctatcacggca
gggttctttttccatgctgctaggaaagacccgcaggaaggatatagaacactggtggag
aaccagcctgtttatatacacccaagcagcgccctgtttcagagacaaccggactgggtg
atctaccatgagctggtaatgactacaaaggagtacatgcgagaggtaacagtggtagat
cccaagtggctggttgaactggctcccaggttctttaaagtagcagatcccacgaaaatg
agcaagcggaagcgtcaagaacgaattgaaccactttatgatagatatcatgaacctaat
tcttggcggcttagtaaacgacgagcttga

DBGET integrated database retrieval system