KEGG   Gossypium hirsutum (upland cotton): 107926385Help
Entry
107926385         CDS       T04793                                 

Definition
(RefSeq) sirohydrochlorin ferrochelatase, chloroplastic-like
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00860  Porphyrin and chlorophyll metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107926385
Enzymes [BR:ghi01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     107926385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-GeneID: 107926385
NCBI-ProteinID: XP_016712719
UniProt: A0A1U8LHR7
Position
Unknown
AA seq 219 aa AA seqDB search
MMSIESLFIPQTLPLKSSSVDKTARKSTWASLKSPKFQTGPSRIRNFSAKSSLGFENGGF
KQFPNGVGEKDGVIIVDHGSRRKESNLMLNEFVAMFREKSGYPIVEPAHMELAEPSIKDA
FGLCVQRGANRVIVSPFFLFPGRHWYQDIPLLTADAARDHPGASYIITAPLGLHELLVDV
MNDRIKHCLSHVAGDADECAACAGTSKCKLYGLVDVIKT
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgatagaatcattattcatccctcaaactctccctcttaaaagttcttcagtt
gacaaaactgcaagaaaatctacttgggcgtccctcaagtccccaaaatttcaaacgggc
ccttcaaggatcagaaatttctcagcgaagtcaagtttgggcttcgaaaatggtggattc
aaacagttcccaaatggggtcggtgaaaaagatggagttatcatcgtggaccatggttct
cgccgtaaagaatccaatctcatgctaaatgaatttgtggccatgtttcgagaaaaatct
gggtacccaattgttgaaccagctcatatggagttggccgagccatcgataaaagatgca
tttggtttgtgtgttcaacgaggagcaaatcgcgtgattgttagtccattctttctcttc
cctggaaggcattggtaccaggatatcccattgttaactgctgatgctgcaagggatcac
cctggtgcatcgtatataataactgccccactcggcctgcacgagctgcttgtggatgtc
atgaatgataggatcaaacactgcttgagccatgtagctggagatgccgatgagtgtgca
gcttgtgctggaacaagcaaatgcaagctctacggactcgtggatgtaattaaaacttaa

DBGET integrated database retrieval system