KEGG   Gossypium hirsutum (upland cotton): 107926487Help
Entry
107926487         CDS       T04793                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00030  Pentose phosphate pathway
ghi00480  Glutathione metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
Module
ghi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ghi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    107926487
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107926487
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ghi04147]
    107926487
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     107926487
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     107926487
Exosome [BR:ghi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   107926487
  Exosomal proteins of colorectal cancer cells
   107926487
  Exosomal proteins of bladder cancer cells
   107926487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 107926487
NCBI-ProteinID: XP_016712834
UniProt: A0A1U8LI37
Position
Unknown
AA seq 514 aa AA seqDB search
MGSGKWCLQKRDSFRSDSLSGNENVPETGCLSIIVLGASGDLAKKKTFPALFNLYCQGFL
PPDEVHIFGYARTKISDDDLRNRIRGYLVNDRSASPSEDVSKFLQLIQYVSGSYDGAEGF
QLLDKEITKHEISKSSQEGSSRRLFYLALPPSVYPSVCRMIRKYCMNKSDLGGWTRIVVE
KPFGKDLDSVEQPSSQIGELFDEPQIYRIDHYLGKELVQNLLVLRFANRFFLPLWNRDNI
DNVQIVFREDFGTEGRGGYFDEYGIIRDIIQNHLLQVLCLVAMEKPVSLKPEHIRDEKVK
VLQSVLPIKDEEVVLGQYEGYRDDPTVPNHSNTPTFATVILRIHNERWEGVPFILKAGKA
LNSRKAEIRVQFKDVPGDIFKCQKQGRNEFVIRLQPSEAMYMKLTVKQPGLDMSTVQSEL
DLSYRQRYQGVTIPEAYERLILDTIRGDQQHFVRRDELKAAWEIFTPLLHRIDNGEMKPI
PYRTGSRGPAEADELSAKAGYVQTHGYIWIPPTL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaggtaaatggtgccttcaaaaaagagatagttttaggagtgattcattatca
ggcaatgagaatgtgcctgaaactggttgtctctcaataattgttcttggtgcctctggt
gatcttgccaagaagaagactttccctgcgctctttaatctttattgtcagggattttta
ccaccagatgaggtgcacatatttggctatgcaaggactaagatttcggatgatgattta
aggaaccgtattcgtgggtatcttgtcaatgatagaagtgcttcaccctcagaagacgtg
tcaaagttcttacagctgattcaatatgtaagtgggtcatatgatggcgctgagggcttt
cagctattagacaaggaaatcacaaagcatgaaatctcaaaaagtagccaagaagggtca
tctcggagacttttttatcttgcacttccaccatcagtgtatccatctgtttgtaggatg
atcaggaaatattgcatgaataaatctgatcttggcggatggactcggatagttgttgag
aaaccatttggtaaagatttggactctgtagagcaaccaagttcccaaatcggagagttg
tttgatgaaccacaaatctaccgtattgatcactatttgggaaaggaattggtccagaac
ctgttggtacttcgttttgctaatcgcttcttcttgcccctttggaatcgcgacaacatt
gataatgtacagattgtattcagagaggattttggaactgagggtcgtggtggatatttt
gatgaatacggaattatccgtgatattatccaaaaccacctattacaggttctttgtctt
gttgctatggagaagcctgtctctctcaaacccgagcacattcgtgacgagaaagtgaag
gttcttcaatctgtacttccgattaaagatgaagaggttgtactcggacaatatgaaggt
tacagggacgacccaacagttcccaaccactcaaacactcccacatttgctactgttatt
ctccgtatacataatgaaagatgggaaggtgtcccgtttattctaaaggcagggaaagca
ttgaattcaagaaaagcagagatacgtgttcaatttaaggatgttcctggtgatatattt
aaatgtcaaaagcaagggagaaacgagtttgtcatacgcctgcaaccttctgaagccatg
tacatgaagctaaccgtgaagcagcccggtctcgatatgtcaacagtgcaaagtgaacta
gatttgtcatacaggcaacgctatcaaggtgttaccatcccagaggcttatgaacgtctt
atactcgacacgataagaggtgatcagcagcattttgttcgtcgggacgagttaaaggcg
gcatgggagatttttacgcctcttctacacagaattgacaacggtgaaatgaagccaatt
ccataccgaacaggcagccggggtcctgcagaagcagatgagctctcggctaaagccggt
tatgttcaaacacacggttatatttggattcctcccaccttatag

DBGET integrated database retrieval system