KEGG   Gossypium hirsutum (upland cotton): 107926973Help
Entry
107926973         CDS       T04793                                 

Definition
(RefSeq) copper chaperone for superoxide dismutase, chloroplastic/cytosolic-like
  KO
K04569  copper chaperone for superoxide dismutase
Organism
ghi  Gossypium hirsutum (upland cotton)
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu HMA
Motif
Other DBs
NCBI-GeneID: 107926973
NCBI-ProteinID: XP_016713412
UniProt: A0A1U8LFK9
Position
Unknown
AA seq 333 aa AA seqDB search
MAFLRSLTPATATAIAAASASASASALPAAFVFSSSSSSSSFSSSRNSSHFPNAKSLPFL
SSPPNRLGLTRNFATSPTALNMDSPSTHHNPSQENGSLPDLLTEYMVDMKCEGCITAVKN
KLQTVDGVKSVEVDLSNQVVRILGNSPVKTMNEALEQTGRKARLIGQGVPEDFLVSAAVA
EFKGPQIFGVVRLAQVSMELARIEASFSGLSPGKHGWSINEFGDLTRGAASTGKVFNPSN
EGTAKQPIGDLGTLDVDKNGEAFYTGVKQQLRVADLIGRSIAVYETEDRSDPGLTAAVIA
RSAGVGENYKKICACDGTTIWEASDKDFVTSKV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcatttttaaggtcgctgacccctgccactgccactgccatagccgctgcctctgcc
tctgcctctgcctctgctctgcctgccgcctttgttttctcttcttcttcttcttcttct
tccttctcctcttctcgcaattcttctcatttccccaacgcaaaaagcctccctttcctc
tcttcaccacccaatcgcttaggccttacaaggaacttcgcgacctctcccactgctctt
aacatggattctccctctactcatcacaacccatctcaggaaaatgggtccttgcctgac
cttcttactgagtatatggtggatatgaaatgtgaaggttgtattactgcggtcaagaat
aagctacaaacagttgatggagtcaagagtgtggaagttgacttgagcaatcaagtggtg
agaatacttggtaattcgcctgtgaaaaccatgaatgaagcattggagcagactggtcga
aaagctagattaataggtcaaggagtgccagaagactttttagtttctgcagctgttgct
gagttcaaagggccacaaatttttggtgtggttcgattggctcaagtgagtatggaactg
gctaggattgaagccagttttagtggtctgtcacctggaaaacacggttggtcaattaat
gaatttggtgatctgacaagaggtgctgcaagtacagggaaagtgtttaatccatcaaat
gaaggaactgctaaacagccaattggcgacctgggaactctagatgtggataagaatggt
gaagccttttacactggtgtcaaacagcaactcagggttgctgatctcattgggcggtca
atagctgtttatgagactgaagatagatcggatccaggtctgacggctgcagtgatagcc
cgaagtgctggggttggtgaaaactacaagaagatatgtgcatgtgacggtaccaccatc
tgggaagcaagtgacaaagattttgtcaccagtaaggtctaa

DBGET integrated database retrieval system