KEGG   Gossypium hirsutum (upland cotton): 107927450Help
Entry
107927450         CDS       T04793                                 

Definition
(RefSeq) heat shock 70 kDa protein 6, chloroplastic-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03040  Spliceosome
ghi04141  Protein processing in endoplasmic reticulum
ghi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107927450
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107927450
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107927450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ghi01009]
    107927450
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ghi03041]
    107927450
   03009 Ribosome biogenesis [BR:ghi03009]
    107927450
   03110 Chaperones and folding catalysts [BR:ghi03110]
    107927450
   04131 Membrane trafficking [BR:ghi04131]
    107927450
   03051 Proteasome [BR:ghi03051]
    107927450
   03029 Mitochondrial biogenesis [BR:ghi03029]
    107927450
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ghi04147]
    107927450
Protein phosphatases and associated proteins [BR:ghi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107927450
Spliceosome [BR:ghi03041]
 Complex B
  Other components
   Prp19 complex
    107927450
 Complex C
   Prp19-CDC5 complex
    107927450
Ribosome biogenesis [BR:ghi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107927450
Chaperones and folding catalysts [BR:ghi03110]
 Heat shock proteins
  HSP70 / DNAK
   107927450
Membrane trafficking [BR:ghi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107927450
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107927450
Proteasome [BR:ghi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107927450
Mitochondrial biogenesis [BR:ghi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107927450
Exosome [BR:ghi04147]
 Exosomal proteins
  Proteins found in most exosomes
   107927450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA StbA BcrAD_BadFG FGGY_C Hydantoinase_A PilM_2 DUF5398
Motif
Other DBs
NCBI-GeneID: 107927450
NCBI-ProteinID: XP_016713991
UniProt: A0A1U8LHA9
Position
Unknown
AA seq 704 aa AA seqDB search
MASSTAQIHVLGGIGFASSRKPNHHAPRTVFFGQRLGKPSPLNAAFLRLAKTNGKRYNVG
PVRVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKTGDRLVGQIAK
RQAVVNPENTFFSVKRFIGRKMSEVDEESKQVSYKVVRDDNGNVKLECPAIGKQFAAEEI
SAQVLRKLVDDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAA
SLAYGFEKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDWL
ADSFKRDEGIDLLKDKQALQRLTETAEKAKMELSSLTQANISLPFITATADGPKHIETTI
TRVKFEELCSDLLDRLKTPVENSLRDAKLSFQDIDEVILVGGSTRIPAVQELVRKMTGKE
PNVTVNPDEVVALGAAVQAGVLSGDVSDIVLLDVSPLSLGLETLGGVMTKIIPRNTTLPT
SKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDA
NGILSVTAVDKGTGKKQDITITGASTLPNDEVDRMVKEAEKFSKEDKERRDAIDTKNQAD
SVVYQTEKQLKELGDKVPGPVKEKVEAKLQELKDAIAGDSTQGMKDAMAALNQEVMQLGQ
SLYNQPGAGGSSAGPAAGGETGPSDSSNKGPEGDVIDADFTDSK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccactgctcaaatccacgtactcggtggcatcggtttcgcttcttctcga
aaacccaaccaccatgcacccagaaccgttttcttcggtcaacgacttggtaaaccgtcg
ccgttaaacgcagccttcttacggttagcgaaaaccaatggaaaacggtacaatgttggg
ccggttagagttgtgaacgagaaagtggtcggaatcgatctcgggactactaactcggcg
gttgcggctatggaaggagggaaacccacgattgttacgaacgcggaagggcaaagaacg
acgccgtcagtggtggcgtatacaaagactggggataggttggttgggcagattgctaaa
cgacaagccgtcgttaaccctgagaatacgttcttctctgttaagaggtttattgggagg
aagatgtcagaagtggacgaggaatctaaacaggtttcttataaggttgtaagggatgac
aatggtaatgttaagcttgagtgtcctgccattggtaaacaattcgccgccgaggaaatt
tcagctcaggttttaagaaagcttgttgatgatgcttcaaagtttttaaacgataaagtg
acaaaagctgttgttactgtccctgcgtacttcaatgattcccaacggacagcaacaaaa
gatgccggtcgaatcgccgggttagaagttcttcggattatcaatgaacctacggctgcc
tctttggcatatgggtttgagaagaagaacaatgaaaccatccttgtgtttgatcttgga
ggtggtacttttgatgtttcagtgcttgaagttggtgatggagtgtttgaggtgctttct
acatctggggacacacatttgggtggtgatgactttgataagagaattgttgactggctt
gctgacagcttcaagagagatgaaggcattgatcttttgaaagacaaacaagctcttcag
cggttaaccgagacagctgagaaagctaaaatggagttatcatctttgactcaggcaaat
ataagtttacctttcattactgccacggcagatgggccaaaacacattgagaccaccatt
accagggttaagtttgaggaattgtgctcagaccttcttgacaggctcaagacaccagtg
gagaattcccttagggatgcaaaattgtcctttcaagacatagatgaggttattcttgtt
ggtggatcaacacgtatcccggctgttcaggaacttgtgaggaagatgaccggcaaggaa
cctaatgtgactgtcaatccagatgaagttgttgccttgggtgctgcagttcaggctggt
gttttatctggagatgtcagtgatattgtgcttttggatgtgtccccgttgtcacttggt
ctcgaaactcttggtggtgtcatgaccaaaatcatcccaagaaacaccacacttcccacc
tccaaatcggaggtgttttcaacagctgctgatggccagacaagtgttgagatcaatgtt
ctccaaggtgaaagagaatttgttcgggacaacaaatctcttggcagcttccgactcgat
ggtattccaccagcaccacgtggtgttccccagattgaagttaaatttgacattgatgcc
aatggcatcctttctgtaactgctgtcgataaaggaaccgggaagaagcaggacatcact
attactggtgccagtactttgccaaatgacgaggttgatagaatggtaaaggaagctgag
aagttttcaaaggaggataaggagagaagggatgccattgacacaaagaaccaagctgat
tccgttgtctaccagactgagaagcagctgaaagagcttggagacaaggttcctggtcca
gtcaaagagaaagttgaggcaaagttacaagaactcaaggatgcaattgcaggggactca
acacaagggatgaaggatgccatggctgcactcaaccaagaagttatgcaactaggccag
tcactttacaaccaacctggtgccggaggcagcagtgcaggacctgcagctggtggtgaa
accgggccttcagattcatcaaacaagggtcctgaaggggatgtaattgatgcagatttc
actgacagcaagtga

DBGET integrated database retrieval system