KEGG   Gossypium hirsutum (upland cotton): 107927706Help
Entry
107927706         CDS       T04793                                 

Definition
(RefSeq) mitogen-activated protein kinase 15-like isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107927706
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107927706
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ghi03036]
    107927706
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ghi04147]
    107927706
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107927706
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107927706
Chromosome and associated proteins [BR:ghi03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107927706
Exosome [BR:ghi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107927706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 107927706
NCBI-ProteinID: XP_016714301
UniProt: A0A1U8LI73
Position
Unknown
AA seq 555 aa AA seqDB search
MQPDQRRKSAADVDFFTEYGEGSRYRIEEVIGKGSYGVVCSAYDTHTGEKVAIKKINDIF
EHVSDATRILREIKLLRLLRHPDIVEIKHILLPPSRREFKDIYVVFELMESDLHQVIKAN
DDLTPEHYQFFLYQLLRGLKYIHTANVFHRDLKPKNILANADCKLKICDFGLARVAFNDT
PTAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQL
DLMTDLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPLSHKFPNADPLAVLLLERMLAFE
PKDRPSAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYH
PKMLKEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGTTAAPLERQHASLPRPCVLYS
DNSVQNSTDVTDNLSKCSIKETEKPQTERSFPIPMSRLPPQVPQSIQAGAARPGKVVGSV
LRYNNCGAVAAGEALEQRRMARNPSVPTQYTATNCSYPRRNPVCKDDEENELQPKPQYMA
RKVAAAQGGSRSQWY
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgatcagagaagaaagtcagctgcggatgtagattttttcactgaatatggt
gagggaagcaggtatagaatagaggaagtaattggaaaaggaagctatggtgttgtttgt
tcagcgtatgacacgcatactggagaaaaggttgcaattaagaaaatcaatgatatattt
gaacatgtatctgacgccacccgaatcctcagagagattaaacttctcaggctcctacgt
catccagacattgttgagatcaagcacatattgttgcctccttcaagaagggaatttaaa
gatatatatgtggtatttgaacttatggaatctgatttacaccaggttatcaaagcaaat
gatgatttgaccccagaacactaccagttttttctttatcagcttcttcggggcctgaaa
tacattcacacagctaatgtttttcatcgggatctaaagccgaaaaatatcttagccaat
gctgattgcaaactgaagatctgtgattttgggcttgcaagagtagcttttaatgacacc
cccactgcaatattctggacggactatgttgcaacaagatggtacagggctccggaattg
tgtggatcctttttctccaagtataccccagcaatagatatatggagcattgggtgcatc
tttgctgaacttctaacagggaaacctctgtttcctggaaaaaatgttgtccatcaattg
gatctgatgactgatcttttgggaacaccatctgctgaagccattgctagggtgcgtaat
gagaaagctcggagatacttgagcagcatgcgaaagaaaaagccaattcctctctcccac
aagttccctaatgcagatcctcttgctgttcttttgttagaaaggatgcttgcttttgaa
cccaaggatcgacctagtgctgaagaggccctagctgatccatatttcaaggggttggcc
aaagttgaaagggagccttccgcacaaccagttaccaagatggaatttgagtttgagaga
cgtaggattacaaaggaagatgttagggagctcatataccgtgaaattcttgagtatcat
cctaaaatgttgaaagagtatctggaaggatcagagccaactggcttcatgtatccaagt
gcggttgaccatttcaagaagcagtttgccttccttgaggagcactatggaaatggtacg
actgcagctccacttgagagacaacatgcatctttgccaaggccatgtgtgttatattca
gataattcagtacaaaactcaacagatgtgacagataacttatctaaatgttccatcaag
gaaactgagaaaccccaaacagagagaagctttccaatccctatgtcaaggcttccccct
caagttcctcaaagcatccaagcaggtgctgccagacctgggaaagtagttggatcagta
ttgcgatacaacaattgtggggcagtagctgcaggtgaggctcttgaacagcgaaggatg
gctcggaatccttcagttccaactcagtatactgccacaaattgctcatatccacggaga
aatcccgtctgtaaagatgatgaagaaaatgaattgcagccaaaaccccagtacatggct
aggaaagttgctgctgcccaaggtggatcaagaagtcagtggtattga

DBGET integrated database retrieval system