KEGG   Gossypium hirsutum (upland cotton): 107928122Help
Entry
107928122         CDS       T04793                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00052  Galactose metabolism
ghi00500  Starch and sucrose metabolism
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107928122
   00500 Starch and sucrose metabolism
    107928122
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107928122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107928122
NCBI-ProteinID: XP_016714795
UniProt: A0A1U8LJU8
Position
Unknown
AA seq 441 aa AA seqDB search
MYYNGIYHLFYQYNPKGAVWGNIVWAHSESKDMVNWEALEPAIYPSESFDINGCWSGSAT
VLPENKPVIFYTGIDPNQYQVQNYAVPENLSDPYLRKWVKPADNPIVVADETMNKTAFRD
PTTAWKIGGHWRMVVASRRKQRGIAYLYRSRGFRKWVKAKHPLHSVPNTGMFECADFFPV
SLSGDTGLDNSAFGPNVKHVLKVSLDLTRYEYYTIGSYFPEARDKYVVGKGFVDGWNGLR
FDYGNFYASKTFFDPSKNRRILWGWTNESDTAQDDVQKGWAGLQAIPRKVWLDPSGKQLL
QWPIEEIETLRGQNVQLSNQELKSGEHIEVKAITAAQADVDITFSIPNLDKAEPFDPSWT
NAQDLCGLKGSTVQGGVGPFGLLTLASEKLEEYTPVFFRVFTGLYKHVVLLCSDSGRLIT
RWWRVSGPGEKHASLREYIHW
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtattacaatggcatttaccatttattctatcaatacaaccccaaaggtgcagtttgg
ggcaacattgtttgggctcattcagaatccaaagacatggtcaattgggaagctctcgag
cctgcaatttatccttcagaatcttttgatatcaacgggtgttggtcaggatccgctacg
gttcttccggaaaataagcctgtaattttctacacagggattgatcctaatcaatatcaa
gtgcaaaactatgctgttccagagaacttatctgacccttatttgcgtaaatgggtcaaa
ccggctgacaaccctatcgtggttgccgatgaaaccatgaataaaaccgctttccgtgac
ccaacaactgcttggaagatcggtgggcattggagaatggtggtggctagccgaaggaaa
cagagagggattgcttatttgtatagaagtaggggtttcaggaaatgggtaaaggccaaa
catcctttacattcggtgccgaatactggcatgtttgaatgtgcagattttttcccagtg
tcattgtctggggacactggccttgacaactctgcttttggccctaatgttaagcatgtt
ttgaaggtaagcttagatcttacaaggtatgagtattatactataggttcgtatttccca
gaagcaagggataaatatgtggttggtaaggggtttgttgatggttggaatgggcttaga
tttgactacgggaatttttatgcttcaaagacattttttgacccttcaaagaataggagg
attttatggggttggaccaatgaatcggatactgctcaagatgatgttcagaaaggatgg
gctggtcttcaggcaattccaaggaaggtgtggcttgatcctagtgggaagcagttgctg
caatggcctattgaagaaatagagactcttagaggccaaaatgttcaattgagcaatcaa
gaactcaagtcgggagaacatattgaagtcaaagcaattactgctgctcaggctgatgtt
gacattaccttctccatacctaacttggacaaagctgaaccgtttgatcctagctggacc
aatgctcaggatctctgtggccttaagggttcaactgttcaaggtggcgttggaccgttt
gggctcctaacattagcttcagaaaagttagaagaatatacccctgtttttttcagggta
tttacaggtctatacaagcatgttgttctcttatgctcagattctgggagattgatcact
cggtggtggagagtttcggggccgggggaaaaacatgcatcacttcgagagtatatccat
tggtag

DBGET integrated database retrieval system