KEGG   Gossypium hirsutum (upland cotton): 107929756Help
Entry
107929756         CDS       T04793                                 

Definition
(RefSeq) (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    107929756
Enzymes [BR:ghi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     107929756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth ANTAR
Motif
Other DBs
NCBI-GeneID: 107929756
NCBI-ProteinID: XP_016716751
UniProt: A0A1U8LQ81
Position
Unknown
AA seq 361 aa AA seqDB search
MLELYEAAHFQLHGENILEEALSFTTFHLKLAETTVNYPLSIQIANALKRPIRKSLPRLI
ARSYISIYEAYGTQDENLMKFAKLDFKILQYLHKMEINNINRWWKGLDVATNFPFIRDRF
VECYFWILGVYFEPHYAIARTFATKVICLVSILDDIYYAYGTYEEFEIFTKAIQRWDTNC
IDQLPDYMKLWYSETLNVYKDMEDLMSKDGKSYRVQVAIEAMKRQSQVYYVEAKWLHENY
IPTMEEYIPIALVSCGYWNLTVSSFVGMEDSITKETFNWAFNDPKIVRASCTICRLMSDI
VGHKVERERGHVSSAVECYMKQYGVSMQEAYDKLYKQINNAWKDINEEFLKPTAAPTSVL
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgctagaattgtatgaagctgcacactttcaactgcatggggaaaatatattagaagaa
gccctttccttcactacatttcatctcaagttggcagaaactacggtaaactatcctctc
tccatacaaattgctaatgctctaaagcgacccattcgcaagagcttgccaaggttgatt
gcaaggagctacatttccatatacgaggcatacggtacccaagatgaaaatttaatgaaa
tttgcaaagttagatttcaaaatcttacaatatttacacaagatggagataaacaacata
aacaggtggtggaaaggtttagatgttgcgactaattttccttttataagggatagattt
gtggaatgttatttttggattttgggtgtatactttgaaccccactacgccattgctaga
acttttgctaccaaagtgatatgcctcgtatcaattttggatgatatttattatgcgtat
ggcacatacgaagaatttgaaatctttacaaaagcaatccaaaggtgggataccaactgc
attgatcaacttccagactacatgaaattgtggtatagtgaaaccttaaatgtttataaa
gatatggaagatttgatgtccaaagatggaaaatcatatcgcgtccaagtcgcaatagaa
gcaatgaaacgacaatctcaagtttactatgttgaggccaaatggttgcatgaaaattac
ataccaacaatggaggagtatataccgattgcattagtctcttgtggttattggaatctt
acggtgtcatcttttgttggcatggaagatagcataacaaaagagacattcaattgggca
tttaatgaccctaagattgtcagagcttcatgcaccatttgtaggctgatgagtgatatt
gttggccacaaggttgagagagagagaggacatgtgtcctcagcagtggagtgttacatg
aaacaatatggggtgtcaatgcaagaggcctacgataagttatacaagcaaataaacaat
gcttggaaggatataaatgaagagttcttgaaaccaacagcagcaccaacatcggttctt
aattga

DBGET integrated database retrieval system