KEGG   Gossypium hirsutum (upland cotton): 107931490Help
Entry
107931490         CDS       T04793                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK3 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107931490
   01009 Protein phosphatases and associated proteins [BR:ghi01009]
    107931490
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107931490
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: Other
  Wnk family
   107931490
Protein phosphatases and associated proteins [BR:ghi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107931490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 107931490
NCBI-ProteinID: XP_016718879
UniProt: A0A1U8M024
Position
Unknown
AA seq 621 aa AA seqDB search
MVQDTMSDQEQDDPDAEFVEIDPTGRYGRYNEVLGRGAFKKVYRAFDELEGIEVAWNQAK
ITDLLRNSEDLERLYSEVHLLKTLKHKNIIKFYNSWVDTKNEHINFITEIFTSGTLRQYR
KKHKHVDLRALKKWSRQILEGLLYLHGHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAA
ILRQARAAHSVIGTPEFMAPELYEEEYNELVDIYAFGMCLLELVTFEYPYVECANAAQIF
KKVTSGIKPASLAKVTDPGVKLFIEKCIAKASERLSAKELLRDPFLQPVEENDSVGRSLR
LNPKTSESTTEDLQSETSLDVRVQGQMKDLNTIFLKLRIADSTGQVRNIHFPFDIEADTA
IAVASEMVEELDLTDQDVLTIATMIESKIQSHIPDWISRESPSNSIGEIAYSDISESKGD
GSLMAHEPTSSPGRLSLERLPSGRRYWSDSPIAAGGFSLSRFGFSNVRSPDNWAEHYEQS
HDCYEGGANINRGTSLDRVANEVTHHSGRGDDDGLGKDENRPADMQSSVSGKNNLHDNNG
THSSKENCKQLKDTESKVKVITENLESLLVKQQLELDELKNKHQLTISDLLSELPPEILE
KVLATCKLKIPKYDIQDATNH
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggatacaatgtccgatcaagaacaagatgatcccgatgctgagttcgtcgag
attgatccaacgggtcgttatggtcggtacaatgaggttttaggaagaggagctttcaaa
aaagtatacagagcatttgatgaactggaaggtatagaagtggcatggaatcaggctaag
attaccgatttattgcgaaattcagaagatttggagcgtttatattctgaagttcatttg
cttaaaacattgaagcacaagaatataattaagttttacaattcgtgggttgatactaaa
aatgaacatatcaacttcatcacggagatttttacttcgggaacactgcggcagtatagg
aagaagcataagcatgttgatttgagggcattgaagaaatggtctaggcagatcttagag
ggtcttctttatcttcacggtcatgaccccccggtgattcaccgggatctgaaatgtgat
aacatcttcgtgaatggcaaccaaggtgaggtgaagatcggggatctagggttggctgct
attcttcgccaggctcgtgcagcacatagtgttattggtacaccagagtttatggcaccc
gaactctatgaggaggaatacaacgagcttgtagatatttacgcttttggcatgtgtttg
ctggagttagtgacatttgagtatccatacgttgaatgtgctaatgctgctcaaatattc
aagaaggtgacatcgggaataaagcctgcatcgttggcaaaagtgactgatcctggagta
aagttatttattgaaaaatgtatagctaaagcttctgaacggttgtctgctaaggaactt
ttacgggacccatttctccaacctgttgaggaaaatgacagtgtaggtcgttctttacga
cttaatcccaaaacttcagagagcaccaccgaggatcttcaatctgagacgagtctagac
gttagagtgcaaggtcagatgaaagaccttaacacgatatttctgaaactaaggatagca
gattcaacaggtcaagttcgcaacatccacttcccatttgatatcgaagccgatacagca
attgctgttgctagtgaaatggttgaggagttggacttaacagatcaagatgttctgaca
attgccacaatgattgaatctaaaatccaatcccacattcctgattggatttcccgagaa
agtcctagcaatagtattggagaaattgcatattccgatatctctgaaagtaagggtgat
ggatctctgatggctcatgaaccaacctcatctccaggtcgtctttcactagagagattg
ccatcaggtcgaagatactggtctgactcacccattgcggctggtggattctctctgtcc
aggtttgggttctcaaatgtacggtctcctgataactgggctgaacattatgagcaatct
catgattgttatgaaggcggagctaacataaacaggggtacttcacttgatcgagtggca
aatgaggtcacacatcacagtggcagaggtgatgatgatggcctcggtaaagacgaaaac
cgacctgccgacatgcaatcgagtgtgtccgggaagaacaaccttcatgacaataacgga
acacattcatcaaaagagaactgtaagcaattaaaggacactgaatcaaaagtgaaggta
ataaccgaaaatctcgagtccttgttagtaaagcagcaactagagttagatgagctgaag
aataagcaccagttaaccatatctgaccttctgagtgaacttcctccggaaatccttgaa
aaggttttggctacgtgtaagcttaagattcccaaatatgatatccaagatgcaacaaac
cactaa

DBGET integrated database retrieval system