KEGG   Gossypium hirsutum (upland cotton): 107933055Help
Entry
107933055         CDS       T04793                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00071  Fatty acid degradation
ghi00592  alpha-Linolenic acid metabolism
ghi01040  Biosynthesis of unsaturated fatty acids
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01212  Fatty acid metabolism
ghi04146  Peroxisome
Module
ghi_M00087  beta-Oxidation
ghi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107933055
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107933055
   00592 alpha-Linolenic acid metabolism
    107933055
   01040 Biosynthesis of unsaturated fatty acids
    107933055
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107933055
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107933055
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     107933055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 107933055
NCBI-ProteinID: XP_016720696
UniProt: A0A1U8M1L2
Position
Unknown
AA seq 672 aa AA seqDB search
MERAFQRTQVLTNHLLQSSSPLPSQTLSSNACLSYSPPELSENCAFDVKEMRKLIDGHNL
EERDWLFGLMKQSELFNPKVRGGKVFVSPDYNQSMEQQREMTLKRIKYLQERGVFKGWLT
EKGEEIEMRKFAGFEVFSIYDHSLFTKLGVHFPMWGGAIQFCGTKHHHDKWLRDTENYSI
KGCFAMTELGHGSNIRSLETVTTYDSNTGEFVINTPCESAQKFWIGGAAKHATHTVVFSQ
LHINGINQGVHAFIVQIRDVDGNICPNIRIADCGHKVGLNGVDNGRIWFDNVRVPRENLL
NSVADVSPDGKYLSSIKNPDQRFAAFMAPMTVGRVNIAIGAVYQSKVALAITIRYALTRR
AFSLKPNEPEVLLLDYPSHQRRLFPLVAKTYAMSFAANYLKVLYAKRTPQSNKAIHIVSS
SFKATFTWNNMQILQECREACGGQGLRTENRVGHLKGEYDVQSTFEGDNFLLMQLVSKAL
FAEYMAAQKRNKVFKGLGLEHMNKPCPVIPSQLTSTTLRCSQFQMDALCLRERDLLNRFV
ANVLKCKAKGENTEQAFNLCYELAKDLGRAFSERAIFQTFVEAESTLPAGSLKDVLGTLR
SLYASISIEDVSFLRYGYLSVDNGANVRREITKLCNELRPHALALISSFGIPDAFLSPIA
FNWIDTNSWSLV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggaacgagctttccaacgaacccaagttctcaccaatcatctcctccaatcctcctca
ccattgccgtcccaaaccctttcttcgaatgcttgtttaagctactcaccgcctgaactt
tccgagaactgtgcgttcgacgttaaagaaatgaggaagctgatagatggccacaacttg
gaggaacgggattggttgttcgggttgatgaagcaaagtgagctgttcaacccgaaggta
aggggagggaaggtgttcgtttcgccggactataaccagtcgatggagcaacagcgggag
atgacgttgaaacgaatcaagtatttgcaagagagaggagtttttaaaggatggttaacg
gagaaaggggaagagattgagatgaggaaattcgctggttttgaggttttcagtatttat
gatcattccctcttcactaagcttggagttcacttccccatgtggggaggtgccatccaa
ttttgcggtacaaaacaccatcatgacaagtggctgagggacaccgagaattattcgatc
aagggttgctttgcaatgacagagttggggcatggaagtaatattcgcagtcttgaaaca
gtaacaacatatgattcgaatacaggggagtttgtcattaatacgccttgtgaatcagct
cagaagttttggattggtggggcagccaagcatgcgacgcatacagttgtgttttcacag
ctacatattaatggaatcaatcaaggggttcatgcatttatagtccaaatcagggatgtt
gatggtaacatatgtccaaacattcgtattgctgactgtggtcacaaagttggtttaaat
ggtgttgataatggtcgaatctggtttgacaatgttcgagtgcccagagagaacttgtta
aattcggttgctgatgtttcccctgatggaaaatatctaagttcgataaaaaacccagat
cagagatttgctgcattcatggcccctatgacagtaggtcgtgttaatattgctattggt
gcggtttaccaatcaaaggttgctttagcaattaccattaggtatgcactaacaaggcgg
gctttttctctcaaaccaaacgagcctgaggtcttattgctcgattacccaagtcatcaa
cgccgactcttccctcttgttgcaaagacttatgctatgagttttgcagcaaactacttg
aaagtgctgtatgcaaagaggacacctcagtcaaacaaggccattcatatagtttcaagt
tcattcaaagctacttttacttggaataacatgcaaatacttcaggaatgtcgcgaagct
tgcggcggacaagggttaaggaccgagaatcgtgttggtcatctgaaaggtgaatatgat
gtgcaatccacttttgagggtgataattttcttctgatgcagctggtcagcaaggctctt
tttgctgaatacatggcagctcagaaaagaaacaaggttttcaaagggctgggcttagaa
cacatgaataaaccctgccctgtcattccatcacagcttactagcactaccctccgatgc
agtcaattccagatggatgccttgtgcttaagggagagagatcttttgaatcgttttgtt
gcgaatgtcttgaaatgtaaagccaagggagaaaatacagagcaggcctttaatttgtgt
tatgagctagcaaaagatttgggcagggctttctcggaacgagcaatatttcaaacgttt
gttgaagcagaatcaactctacctgctggttcattgaaggatgtcctaggtacattgaga
tcattatatgcctcgattagtatcgaagatgtttcgtttctacgatacgggtacctatca
gtggacaatggggccaatgtaaggagagaaataacaaaactgtgcaatgaacttcgacct
catgcacttgctttaatcagttccttcggcatccccgatgcttttctcagccccatagct
tttaactggatcgatacgaactcttggtctttggtttaa

DBGET integrated database retrieval system