KEGG   Gossypium hirsutum (upland cotton): 107934912Help
Entry
107934912         CDS       T04793                                 

Definition
(RefSeq) probable protein S-acyltransferase 22
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ghi04131]
    107934912
Enzymes [BR:ghi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     107934912
Membrane trafficking [BR:ghi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107934912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC LPG_synthase_TM DUF2755
Motif
Other DBs
NCBI-GeneID: 107934912
NCBI-ProteinID: XP_016722924
UniProt: A0A1U8MBJ9
Position
Unknown
AA seq 626 aa AA seqDB search
MRKHGWQLPSHPLQVVAVAVFLALGFAFYVFFAPFVGKKMFQYIVMGIYTPLITCCFGLY
IWCAAADPADPGVFKSKKYLIIPESGKYSGPKDCKLGGGSATTLHDDNDALVGGKTAEKD
TAATDETLKDGAVELEGNDGSMKQSSCLLWIFSPCAVICKCCGSNEESSEQQMSEDGMFY
CSLCEVEVFKYSKHCRVCDKCVNHFDHHCRWLNNCIGKRNYRQFFTLMVSAILLLILQWS
TGILVLICCFVDRKQFSLDISTKLGSSFSLVPFIIVVALCTILAMVATLPLAQLFFFHIL
LIKKGISTYDYIIALREQEQELQGVGGQQSPQMSPASSLTGLSSASSFSTFHRGAWCTPP
RLFLEDQFDVVPPDTGSVSSFGKKMVREEPIKKKNPGAVKISPWTLARLNAEHVSKAAAE
ARKKSKILQPVVRRDAPFGLEGDNSFGSSGRRMFPRPDGNRRRAAKRVRLPADLPMESIM
NISSKPADKGFTDTSSSLAPLQLEARSAFQTSRAMSSSVGVVTSSPESSLDSPDIHPFRV
SSSGAEESRHRTGLPPFNMAGQKGFPLSRSASDGYEASGGEDSDRVPSRIVHRPTNWNNI
LFSEQTERVVKLKTPSSSGPVNGRML
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcatggatggcagcttccttctcatccacttcaggtggtggctgttgctgtg
ttcttggcacttggatttgctttctatgtgttctttgctccttttgttgggaagaaaatg
tttcaatatattgtgatgggaatctatacccctcttattacttgttgctttggcctatat
atttggtgtgcggcggcagatcctgcagatcctggagtttttaagtctaaaaagtatctt
ataattcctgaaagcggaaagtattctggaccaaaagactgtaaattaggtggaggttca
gctacaaccttgcatgatgataatgatgctttggttggaggaaaaactgcagaaaaggac
acagcagcaactgatgaaaccttgaaagacggtgctgttgaacttgagggaaacgatggt
tcaatgaagcagtcttcttgtttgctatggattttctctccttgtgctgttatttgcaaa
tgctgtggctcgaatgaagaatcttccgagcaacagatgagtgaagatggaatgttctat
tgcagtttgtgtgaagttgaggttttcaaatacagtaagcactgccgagtctgtgacaaa
tgtgtcaaccatttcgatcatcactgcaggtggctaaacaattgtataggcaaaaggaac
taccgacaatttttcactctcatggtgtcggctattctattgcttattctacaatggtca
accggaatcctcgtacttatctgctgtttcgttgaccggaagcagttttctttggatatt
tcaacgaagttaggaagcagtttctctttggttccgttcattattgtggttgcattgtgc
acaattttggctatggtagcgacgttaccgcttgcacagctattcttctttcacattcta
ctcataaaaaagggaatcagcacatacgattatataatagctttacgggagcaagagcaa
gagctacaaggtgtcggtggccaacagagtccacaaatgtcccctgccagctcgcttact
ggattaagtagtgctagttcgttttctactttccaccggggtgcatggtgtacaccccca
cgcttgttcctcgaagatcagtttgacgttgttcctcctgataccggatctgtaagttcg
ttcgggaaaaaaatggtccgggaggaaccgattaagaagaagaatccaggtgcagttaag
atcagtccgtggacattggcacggttaaatgcggaacatgtttcaaaagccgctgctgaa
gcaaggaaaaagtccaaaatcctgcagcccgttgtgagacgtgatgccccatttgggtta
gaaggggataatagctttggcagcagtggccgacgaatgttcccaagacctgatggcaat
agaagacgagcagctaagcgggtgcgtctacccgcagacctacccatggagtccataatg
aacatttcgtctaaacctgctgataaaggtttcactgacacatcaagtagcttggcacca
cttcaactagaagcgcggagtgctttccaaacgagccgagcaatgtcgagttcagttggg
gttgttacctcttctccagagagtagtttagattcaccagatattcatccatttcgggtc
tcctcatcaggagccgaagaatcaagacatcgaacaggtttacctcctttcaatatggct
ggtcaaaagggatttccattgtcgagatccgctagtgatggttatgaagcatccggtggg
gaagatagtgatcgagttccatcaagaattgttcatagaccaacaaactggaacaacatt
ctcttttctgaacagaccgagagggttgttaaactcaaaacaccatcttcgtccggtccg
gttaacggtagaatgctgtga

DBGET integrated database retrieval system