KEGG   Gossypium hirsutum (upland cotton): 107937656Help
Entry
107937656         CDS       T04793                                 

Definition
(RefSeq) glutathione gamma-glutamylcysteinyltransferase 3-like isoform X1
  KO
K05941  glutathione gamma-glutamylcysteinyltransferase [EC:2.3.2.15]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107937656
Enzymes [BR:ghi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.15  glutathione gamma-glutamylcysteinyltransferase
     107937656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phytochelatin_C Phytochelatin Peptidase_C39_2
Motif
Other DBs
NCBI-GeneID: 107937656
NCBI-ProteinID: XP_016726075
UniProt: A0A1U8MH07
Position
Unknown
AA seq 495 aa AA seqDB search
MAVAGLYRRVLPSPPAIEFSSPEGKQLFTEALAGGTAEGFFKLISYYQTQSEPAYCGLAT
LAMVLNALAIDPGRTWKGPWRWFDDSMLDCCEPLEKIKSQGITFGKVACLAVCNGAQVEP
FRTDQSSIEDFRERVVSCTSSEDCHLIVSYNRAVFKQTGSGHFSPIGGYHAGKDMVLILD
VARFKYPPHWVPLSLLWDAMNTIDKATGHCRGFMVMSKLQKATSVLYTMSCKHENWNVVA
KYLTEDLPLLLTSKNLKDVNDVLCVVFRSAPSSLRDFIKWIAEVRRQDDGSTILSEEEKG
RVALKEEVLKQIRETELFKNVTGYLGFERSLCESEAPLGYTDSLADSAANVCCQGAGLLT
GKIRLLNGCGKDIKLLNSVCKEPVTVVSGTVTTDGTEQMVDMLIPSSETKPSCLCDFDQN
SCSGIPPSIGDGLTVLIFALPQYTWLGLKEEKLQAEMKGLTSADCLPTLLQEEVLHLQRQ
LYFLKADLNISPSSS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcgggtctttacagaagagttcttccctctcctcctgccatcgagttttct
tctcccgaaggcaagcaattgttcacggaagctttagcgggaggaacggcggaagggttt
ttcaaactaatatcatactaccaaacgcaatcggagcctgcgtattgcggactcgccact
ctcgccatggtcttaaacgccctcgctatcgatcctggtagaacctggaaaggaccttgg
agatggtttgatgattcaatgttagattgttgcgagccactggagaaaatcaaaagtcaa
ggcatcacttttgggaaagttgcttgtttggctgtttgcaatggtgctcaagttgaacct
ttcaggaccgatcaatctagcattgaagatttccgggaacgcgtggtctcttgtacttca
tcagaggattgccatttgattgtctcctacaatagagcggttttcaagcagacaggatcg
ggccatttttctccgatagggggttaccatgctggaaaggacatggttctgattttggat
gttgctagattcaaataccctcctcattgggttcctctttcgcttctttgggatgccatg
aatactattgataaagcaactggacattgtagggggttcatggttatgtctaagcttcag
aaagcaacatctgttctttacactatgagctgtaaacatgagaattggaatgtagtcgct
aagtacttaacagaagatcttccccttttgctcacttccaagaatctaaaagatgttaat
gatgtattatgtgtggtatttagatcagcaccttccagtttgagggatttcatcaagtgg
attgcagaggttcggagacaggatgatggcagtaccattttaagtgaagaggagaaagga
agggttgcactcaaggaagaagtattgaaacaaatacgagagactgaactattcaaaaat
gtgacgggatatttgggatttgagcgttcattgtgcgaaagtgaggcacctttgggttac
acagatagcttggctgacagtgcggcaaatgtttgttgtcaaggagctggacttctaact
gggaaaattaggttgttaaacgggtgcggtaaagatataaaacttctaaactctgtgtgt
aaggagcctgtcacagtggtttctggtactgtaactactgatggcactgaacaaatggtt
gatatgctgattccgtcatctgaaacaaagcccagttgtttatgtgattttgaccaaaat
agttgttctggtatacctccatcaataggggacggtctgacagtacttatttttgcactg
cctcaatatacctggttgggccttaaagaggagaagctacaggcagagatgaaaggcctt
acatctgcagactgtctcccaactttgctccaagaagaggttctgcatttgcaacggcag
ctctatttcctcaaggctgatctcaatatctcaccctcatcttcttga

DBGET integrated database retrieval system