KEGG   Gossypium hirsutum (upland cotton): 107937745Help
Entry
107937745         CDS       T04793                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ghi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107937745
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107937745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ghi01003]
    107937745
Enzymes [BR:ghi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     107937745
Glycosyltransferases [BR:ghi01003]
 Glycan extension
  P blood group
   107937745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 107937745
NCBI-ProteinID: XP_016726194
UniProt: A0A1U8MKS5
Position
Unknown
AA seq 433 aa AA seqDB search
MFQMSKLYHNFHHTKNSVFSFVLLLSLFLLLLLACNGFSVFYINLSVPAKTSPVPANLLP
EILPGDKPVKKLSSSSVMYAVKEENPSLNLKTHLSLLQKPNISMVSKPEKQPHRFSPQTL
KALQLRTTKRTKGFTFSTKLRAFFQNSNCKLRFFMTWISSLHSLSHRELLVIESVFKSNP
KACLVIVSPSLDSPKGNAVLKTFLNMGFNLITVSPDFDSIFKHTYAETWFNRLKTGNINP
GEVSLGQNLSNLLRLVLLYKYGGVYIDTDVIVLKSFNNLSNVIGAQSMNIETKTWSRLNN
AVLVFDKHHPLLYKFIQEFALTFDGNKWGHNGPYLVSRVVGRVTNRPGFNFTVLPPPAFY
PVDWSRIRSLFREPNNGIQSDWLRRKLEQIRRQSYAVHLWNRQSKDVRVEEGSIVHHIIS
DCCIFCNISTSSL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaatgtctaaactttaccataatttccatcataccaaaaattcagtctttagc
tttgtgcttttattatcacttttccttcttcttcttttagcttgtaatggcttctctgtt
ttctacattaacctctctgttcccgccaaaacttcaccggtgcccgccaatttgttaccg
gagatccttcccggtgacaaaccggtgaaaaagttatcatcttcctcagttatgtatgca
gtgaaagaagagaacccatctttaaacttaaaaacccatttatctcttttacaaaaaccc
aacatttcaatggtttcaaagccagaaaaacaacctcatcgttttagtcctcaaacattg
aaggctttgcaattaaggacaacaaaaagaacaaagggtttcactttctccaccaaatta
agggcttttttccaaaattcaaactgtaagcttcgttttttcatgacatggatttcatca
ttacactcattgagtcatagagaattacttgtcattgaaagtgtgttcaaatcaaacccc
aaagcttgtcttgtcattgtatccccttcattagattccccaaaaggaaatgctgtttta
aaaacatttttaaacatggggtttaatttaatcactgtaagtcctgattttgattctata
ttcaagcacacatatgcagaaacatggtttaatcgattaaagacaggcaatatcaatcca
ggtgaggtttctttaggacaaaacctgtctaatctactccgattggtcttgttatacaaa
tacggcggcgtttatatcgacacagatgttattgttttaaaaagtttcaacaatttgagc
aatgtcattggtgcacagtccatgaacattgagaccaaaacatggagtagattaaacaac
gctgtgttggtttttgataaacatcatccattgttgtacaaattcatacaagaatttgca
cttacttttgatggtaataaatggggtcacaatggtccttatttagtttcaagggtagtt
ggtagagttaccaataggcctggatttaacttcaccgtgttgccaccgccggctttttat
ccggtcgattggagtcggatccgaagcttattccgagagcctaataatgggattcaatcg
gattggttacgtcgtaaactcgagcaaatccgaagacaaagctatgctgttcatctttgg
aacaggcaaagcaaggatgttagagttgaagaaggtagcattgttcatcatattatatca
gattgttgtattttttgcaatatttcaacatcaagtttgtaa

DBGET integrated database retrieval system