KEGG   Gossypium hirsutum (upland cotton): 107938242Help
Entry
107938242         CDS       T04793                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ghi04131]
    107938242
Membrane trafficking [BR:ghi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107938242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 107938242
NCBI-ProteinID: XP_016726824
UniProt: A0A1U8MJ22
Position
Unknown
AA seq 1843 aa AA seqDB search
MDGNVATNGNGGGGYRFRRIPRHSLAHLKLDPLLDDNLEQWPHLTELIQCYKSDWIKDDN
KYGHYESISPDSFQNQIFEGPDTDIETEMQLASARQIKAEDATDDDLPSSSGRQFPNSNV
TKHFGQSPLPAYEPAFDWGNERSMIFGQRIPETPTTHYGSGLKISVKVLSLSFQAGIVEP
FYGTMCIYNRERREKLSEDFYFSVLPSEMQDAKVSLEPRGIFYLDAPSASICLLIQLEKP
ATEEGGVTPSVYSRKEPVHLTERERQKLQVWSRLMPYRESFAWAIVPLFDNSIAAASGGS
ASPSSPLAPSMSGSSSHEGVFEPIAKVTSDGKLGCSSGSSVIVEISNLKKVKESYTEESL
QDPKRKVHKPVKGVLKLEIEKHQTALAELDNISEGGSATNDSLDPGEPVADLMFSRSPGN
GLDGPQTSNSKWIAIDGKEVSGNGSNSHGNLDLCADDFQAFDFRTTMRNEPFLQLFHCLY
VYPLTVNLSRKRNLFIQVELRKDGADARRQPLEAIHPRDRGSSHQKYAHTQVAVGARVAC
YHDEIKVSLPAVWTPSHHLLFTFFHVDLQTKLEAPKPVVIGYAALPLSTHAQLRSEISLP
IIRELVPHYLLDSGKERLDYLEDGKNVFKLRLRLCSSLYPINERIRDFFLEYDRHTLRTS
PPWGSELLEAINSLKNVDSTALLQFLHPILNMLLHLIGNGGETLQVAAFRAMVNILTRVQ
QESVDDSERNRSLVNYVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVL
AMAWFFLELIVKSMALEQTRLFYHSLPLDEDVPPMQLKEGVFRCIIQLYDCLLTEVHERC
KKGLSLAKRSTSSLAFFCYDLLSIIEPRQVFELVSLYLDKFSGVCQSVLHDCKLIFLQII
CDHDLFVEMPGRDPSDRNYLSSVLIQELFLTWDHDDLSQRAKAARILVVVLCKHEFDARY
QKPEDKLYIAQLYFPLIGQILDEMPVFYNLNAAEKREVLIVILQIVRNLDDASVVKAWQQ
SIARTRLFFKLMEECLVHFEHRKPADGMLIGSSSRNPVGDAPTSPKYSDKLSPAINNYLS
EASRQEVRPQGTPENGYLWQRVNSQLSSPSQPYSLREALAQAQSSRIGASAQALRESLHP
ILRQKLELWEENLSAAVSLQVLEISEKFSAMAASHSIATDYGKLDCLSSIIMSFFSRNQP
LVFWKAFLPVFNNVFDLHGATLMARENDRFLKQVAFHLLRLAVFRNDNIRKRAVIGLQIL
VRSSFYFMQTARLRVMLTITLSELMSDMQVTQMKSDGTLEESGEARRLRKSLEEMADEVK
SSGLLKECGLPEDALLVTPENFKENRWSWSEVKSLSGSLLLALDASLEHALLGSVMSMDR
YAAAESFYKLAMAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVVMQALVARN
DGVWSKDHVTALRKICPMVSSEITSEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAE
LYHFCASILELVIPVYKSRRAYGQLAKCHTLLTNIYESILEQESSPIPFTDATYYRVGFY
GERFGKLDRKEYVYREPRDVRLGDIMEKLSHIYESRMDGNHTLHIIPDSRQVKAEELQPG
VCYLQITAVDPVMEDEDLGSRRERIFSLSTGTVRARVFDRFLFDTPFTKNGKTQGGLEDQ
WKRRTVLQTEGSFPALVNRLLVIKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGD
QLPRLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCK
RAIRVHFRLIGEEDQDFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5532 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaacgttgctaccaatggcaacgggggcggtgggtatcgctttcggagaatt
cctcgacattcgctcgctcatctcaagctggatccattgcttgatgacaatttggagcag
tggccacatctaaccgaactcattcagtgctacaaaagcgattggattaaagatgataac
aaatatggccactacgaaagtatcagtcccgattcattccagaatcagatatttgaaggt
ccagatactgatattgagactgaaatgcagcttgccagtgctagacaaattaaggctgaa
gatgctaccgatgatgacttgccaagttcctcaggaaggcaatttcccaactctaatgtt
acaaagcattttggtcagtctcctctcccagcttatgaacctgcttttgactggggaaat
gaaaggtcaatgatatttggccaaaggatcccagaaacccctaccacacactatggcagt
gggttgaagatctctgtcaaagttctatcgctttcctttcaagctggaattgttgagcca
ttctatggaaccatgtgcatatataaccgggagagaagagaaaaattatctgaagatttt
tatttttctgttcttccaagtgaaatgcaggatgctaaagtgtctttagaacctcgtggg
atattctatttagatgctccatcagcatcaatctgtttgctaatccagttagagaagcct
gcaacagaagaaggcggtgtaaccccttcggtttattcacgtaaagaaccggtgcacttg
actgagagagagaggcagaagctgcaggtgtggtctcgtctaatgccttacagagagtct
ttcgcctgggccattgttccattatttgacaatagcatcgctgcagcttctggtggatct
gcttctcccagcagtcctcttgctcccagcatgtctggttcaagttctcatgagggtgta
tttgagcccattgctaaggtcacatcagatgggaaactgggttgctcaagtggtagttct
gttattgttgaaatatctaatctaaaaaaagtgaaggaaagctacactgaagagtcactt
caggatcctaaacgaaaagtacataaacctgtaaaaggtgttctgaaattggaaattgag
aaacaccagactgctctcgctgagctggataatatatcagaaggtggcagtgcgacaaat
gattccctggatcctggggaaccagttgctgatttaatgttttcaaggagtcctggaaat
ggtctggatggtcctcagactagcaactccaagtggatcgcaattgatgggaaagaggtt
tctggaaatggatctaacagtcatggaaatctagatttatgtgcagatgattttcaagct
tttgacttccgcacaacaatgagaaatgagccattcttgcagctttttcattgtctatat
gtgtatccgttaactgtgaatttgagtcggaaaaggaatctattcatacaagttgagcta
agaaaggatggtgctgatgctcggaggcagcccttagaggcaatccatccaagggatcgt
ggttcatcacaccagaaatatgctcacacacaagttgctgttggtgctagggttgcctgc
tatcacgatgagattaaagtttcacttcctgctgtctggacaccatcacatcacctgtta
tttacttttttccatgtcgatcttcaaactaaacttgaagctccaaaaccagtagttata
ggatatgcagcacttccattatcgacacatgcccaattgcgatctgaaatttctttaccg
ataataagggaattggttccacattatctcctggattctggcaaggagaggttggattat
ttggaagatggaaaaaatgtattcaaattgcggttaagactttgttcatctctatacccg
attaatgagcgcatcagagatttttttcttgagtatgatagacacactcttcgaacaagc
ccaccttggggttctgaacttttggaggcaatcaacagcttaaagaatgtcgattccact
gctttgcttcagtttcttcacccgattctaaatatgcttctccatcttatagggaatggt
ggagaaacccttcaggttgctgcattcagagccatggttaatatcctgacaagggtgcag
caagagtcagttgatgattctgaacgaaatcgctctctagttaactatgtagattatgct
ttcgatgactttggtggtcgtcaacccccagtttatccgggcttgtctactgtgtggggt
agcttggctcgtagtaaggctaagggttatcgtgttggaccagtgtatgacgatgtgctg
gcaatggcttggttttttcttgagctaattgttaagtcaatggcattggagcaaacacgt
ctgttctatcatagccttccattagatgaagatgttcccccgatgcagttgaaagagggt
gtgttcagatgtataatccagctgtatgattgccttctaactgaagttcatgagcgttgt
aagaaagggctaagcttggcgaaacgatcgaccagcagtctggcattcttttgttatgat
cttttatccattattgagcctcgccaggtttttgaattggtgtccttgtatctggacaag
ttttctggggtatgtcaatcagttctgcatgattgcaagctaatttttctgcagataata
tgtgatcatgatctttttgtggaaatgcctgggagagacccctcagacaggaactatctt
tcatctgtcttgattcaagagcttttccttacttgggatcatgatgatttatctcagcgt
gctaaggcagctagaattttggtggttgttttatgtaagcatgagtttgatgctcggtac
caaaaacctgaagacaagctgtatattgctcaactatattttcccctcattggccagatt
ctagatgaaatgcccgtattttacaacttaaatgctgccgaaaagcgtgaagttttgatt
gttatcttgcaaatcgtgcggaatctggatgatgcatcagttgttaaggcttggcagcaa
agcattgctcgaactagattatttttcaaactcatggaggaatgcctggttcattttgag
caccgaaagcctgctgatggaatgcttataggaagcagttctcgcaatcctgtgggtgat
gcacctacatcaccaaagtattctgataagctttctcctgcaatcaacaattatttatct
gaagcatcgagacaagaagttagacctcagggaactcctgaaaatggttacttgtggcag
agggtgaattctcagctgagctcccctagccagccatattccttgagagaagctctggct
caggcccaatcttctaggattggagcttcagcccaagcacttagagaatctttgcatcca
attttgcgacaaaaactggagctttgggaagaaaacttgagtgctgctgttagtcttcag
gttttagaaatatctgagaaattttctgcaatggcggcatcccatagcattgctactgat
tatggaaaacttgattgtttatcatctataattatgagcttcttttcccgaaatcagcca
ctggttttctggaaagcttttctgcctgtcttcaacaatgtatttgatcttcatggggca
acactaatggctagggagaatgatcgtttcttaaaacaagttgcctttcatctacttcga
cttgcagtctttcgaaatgataatattaggaaaagagctgttattgggcttcagatactc
gtgaggagttcattctacttcatgcagactgcaaggttgagggtaatgctgactatcacc
ttgtccgagctaatgtctgacatgcaggtgactcagatgaagtctgatgggacacttgag
gaaagtggtgaagcacgaaggcttcgaaaatctttagaggaaatggcagatgaagtcaag
agctctggccttttgaaggaatgtggacttcctgaggatgctctattggtaactccagaa
aattttaaagagaatagatggtcctggtcagaagtaaaatctctctctggcagccttctt
cttgcccttgatgctagtctggagcatgcactgttgggctctgtaatgtccatggataga
tatgcagcagcagaaagcttttacaagcttgcaatggcatttgcccctgtcccagatctt
cacataatgtggttgctgcatttgtgtgatgcacatcaagaaatgcagtcttgggctgaa
gctgcacagtgtgctgtggctgttgctggtgttgtaatgcaggctcttgttgctagaaac
gatggtgtttggagcaaggatcatgtgacagccttacgtaaaatttgtcctatggtcagc
agtgaaatcacatcggaggcatcagcagctgaggttgagggatacggtgcttcgaagctc
actgttgactctgctgttaagtacctacaacttgcaaataaacttttctctcaagctgaa
ctctatcatttctgtgcaagcattttggaactcgttattccagtttataagagcagaaga
gcatatggacaactggctaaatgtcatacattgctcacaaacatctatgaatcaatcctt
gagcaggagtcaagccctatccctttcactgatgctacttactatagggttggattttat
ggtgagagatttggtaagctggaccggaaagaatatgtttaccgagaacctcgtgatgtg
cgcttgggtgatataatggaaaaacttagtcatatatatgaatctaggatggatggtaat
catacattgcacattattcctgattccagacaggtgaaggcagaggagttgcagcctgga
gtctgttacctgcagataacagctgttgatccagtcatggaagatgaagatttgggaagc
agaagggaaagaatcttttctctttctactggaactgtccgtgcacgtgtttttgaccgc
ttcttatttgacactccattcacgaaaaatggcaagacccaaggtggattggaagaccaa
tggaaaaggaggactgttcttcagactgagggctcattccctgcacttgtcaataggctc
ttggtgataaaatctgaatcacttgaattttctccggttgagaatgcgattggaatgatt
gaaactcgaacagcagccctacgaaatgagttggaagagcctcgtagttccgaaggagac
caactgcctcgtcttcagagcctgcaaagaattcttcaaggcagtgttgcagttcaagtg
aatagtggtgttctgagtgtgtgcacagccttcttgtctggtgaacctgccacaaggttg
cgttctcaggagctacagcaacttattgctgcactccttgaatttatggctgtttgcaag
cgggcaattcgtgtacacttcagactaataggagaagaagaccaagatttccacacacaa
ctagtgaatggatttcaatctctcacagcagagctatctcattacatccctgcaattcta
tcagagctctga

DBGET integrated database retrieval system