KEGG   Gossypium hirsutum (upland cotton): 107940714Help
Entry
107940714         CDS       T04793                                 

Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA12-like
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    107940714
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ghi03021]
    107940714
Transcription machinery [BR:ghi03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     107940714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C DZR Rhodanese_C zf-CSL UPF0167 A2L_zn_ribbon zf-CHY
Motif
Other DBs
NCBI-GeneID: 107940714
NCBI-ProteinID: XP_016729646
UniProt: A0A1U8MS26
Position
Unknown
AA seq 119 aa AA seqDB search
MAYSQARDFMFCNLCGTMLSLVSPKIAECSLCRSKTSAKGIVGREIGYTLTVEDIRRDLG
ISHAAEEMTTKESAALIKQTCKSCGNAELEYTTRQMRSADEGQTVFLVCPKCKARDTEN
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattctcaagcacgagacttcatgttctgtaacttgtgtggtacgatgctgtct
ttggtttcacctaagattgctgaatgctctttgtgtagatctaaaactagtgctaaaggt
attgtgggacgagaaatcggctacacactcactgttgaggatattcggagagaccttggc
atctcacatgctgcggaagagatgacgacaaaagaatcagctgcgttgatcaagcagact
tgtaaatcctgtggaaacgcagagcttgagtacactacccgacaaatgagatcagcagat
gaagggcagactgtattccttgtatgcccgaagtgtaaagcaagggataccgaaaattga

DBGET integrated database retrieval system