KEGG   Gossypium hirsutum (upland cotton): 107944336Help
Entry
107944336         CDS       T04793                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107944336
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107944336
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107944336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase PAN_2 PAN_3 Saf_2TM Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 107944336
NCBI-ProteinID: XP_016733648
UniProt: A0A1U8N710
Position
Unknown
AA seq 229 aa AA seqDB search
MMKVPAFPDWSSGIYSECKDQCLKNCSCVAYAHDDGIGCMFWGRDLIDVQKFSTSGVDLY
IRLPSSELDKGKSNKVIVITTVITGIVVITISALFLWCRMAKQRGRNKIRRQIEDEEENL
IGAKLQQLPLFNFEELATATDNFHHTKKLGQGGFGPVYRGTLDDGKEIAVKRLSKASGQG
LEEFKNEVVVISKLQHRNLVKLFGCCVEGEEKMLVYEYMPNKSLDSFLF
NT seq 688 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtgccagcatttccagactggtcatcgggtatttatagcgagtgcaaagat
caatgcttgaagaattgttcgtgcgtggcttatgcgcatgatgatggcattggttgcatg
ttttggggtcgagatttgattgacgtgcagaaattctccactagcggagtcgatctttac
attcgtctgccatcttcggaacttgataaagggaaaagcaataaggtcattgtcattact
acagtcattacgggcatagtcgtaataacaatttctgcactcttcttatggtgtaggatg
gctaaacaaagaggaaggaataaaataaggagacagattgaagatgaagaagaaaattta
attggagctaaactccagcaactcccactattcaatttcgaagaactcgccaccgcgacg
gacaacttccatcacacaaaaaagctagggcagggtggtttcggtccagtttacagggga
acattagacgatggaaaggaaatagcagtgaagagactgtcgaaagcttcggggcaagga
ttggaagaatttaagaatgaagtggtggtgatttctaagctccaacatcgaaatctggtt
aagttatttgggtgttgtgttgaaggagaagagaagatgctggtgtacgagtatatgccc
aacaaaagtttggactcttttctctttg

DBGET integrated database retrieval system